Recombinant Rabbit Endothelin B receptor(EDNRB)

Code CSB-CF885629RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9N0W7
Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Sequence EEREMPSAPATPPLLGASEILTPSTKTSWPRDSNASLPRSSAPAEIPKEGRTAGAPRRTP PPCQRPTEIKDTFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGD LLHIIIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS RIKGIGVPKWTAVEIVLIWVVSVILAVPEAIGFNLVTIDYKGSYLRICLLNPTQKTAFMQ FYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFC LVLVFGLCWLALHLSRILKLTLYDQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALY LVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS
Source in vitro E.coli expression system
Gene Names EDNRB
Protein Names Recommended name: Endothelin B receptor Short name= ET-B Short name= ET-BR Alternative name(s): Endothelin receptor non-selective type
Expression Region 27-441
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Non-specific receptor for endothelin 1, 2, and 3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRB sub-subfamily
Database Links

KEGG: ocu:100009477

STRING: 9986.ENSOCUP00000015272

UniGene: Ocu.6857

Pathway Calcium signaling pathway
Melanogenesis
cGMP-PKG signaling pathway

Related Products

EDNRB Proteins

EDNRB Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.