Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)

Code CSB-CF022653RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Srd5a1
Uniprot No.
Alternative Names
Srd5a1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; Steroid 5-alpha-reductase 1; S5AR 1
Species
Rattus norvegicus (Rat)
Expression Region
1-259
Target Protein Sequence
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY HEKFEDYPKSRKILIPFVL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Gene References into Functions
  1. Ziram inhibited SRD5A1 and AKR1C14 activities, thus possibly interfering with neurosteroid production in rats. PMID: 28707553
  2. Exposure of middle-aged rats to environmental enrichment increased mRNA levels of 5al;pha-reductase-1, 3alpha-HSD and cytochrome P450 17alpha-hydroxylase/c17,20-lyase and decreased the methylation state of the 5alpha-reductase-1 gene PMID: 26021641
  3. Low Srd5a1 expression is associated with benign prostatic hypertrophy. PMID: 23405234
  4. Changes in the expression of steroid 5-alpha reductase isoenzymes in the prostate in response to environmental stress. PMID: 23122426
  5. Tesosterone concentrations during postnatal sexual differentiation of the rat central nervous system, among other sex-dependent factors, influence brain levels of 5alpha-Reductase isozymes in adulthood PMID: 22131296
  6. Elevated levels of 5alpha-reduced androgens seen in hyperinsulinemic conditions might be explained on the basis of a stimulatory effect of insulin on 5alpha-reductase in granulosa cells. PMID: 20810561
  7. Thus, the present results indicate that the vitamin E-induced regulation of SRD5A1 and GCLM in rat liver is not directly mediated by changes in promoter DNA methylation. PMID: 20447326
  8. 5 alpha-R1 immunostaining was detected mainly in the white matter (Wm). PMID: 15305365
  9. great sexual dimorphism in the central nervous system (CNS) with respect to both 5alpha-reductase isozymes, and suggest a crucial role of dihydrotestosterone in the sexual dimorphism of the CNS in the female PMID: 16595696
  10. Our results demonstrate that both 5alpha-R isozymes are significantly higher in prefrontal cortex of male rats after acute swim stress in comparison with control rats PMID: 17826869
  11. Our results suggest that 5AR inhibitors elicit antipsychotic-like effects in animals and may be proposed as a putative novel target in the management of psychotic disorders. PMID: 18354385

Show More

Hide All

Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Steroid 5-alpha reductase family
Tissue Specificity
Liver and prostate (at a low level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1