Recombinant Rat 5-hydroxytryptamine receptor 1A (Htr1a)

Code CSB-CF010881RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Htr1a; 5ht1a; 5-hydroxytryptamine receptor 1A; 5-HT-1A; 5-HT1A; Serotonin receptor 1A
Species
Rattus norvegicus (Rat)
Expression Region
1-422
Target Protein Sequence
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
  1. Results reveal a somatosensory/viscerosensory mechanism which exerts tonic inhibitory influence on homeostatic regulation of breathing independent from the classical chemoreflex excitatory pathways. PMID: 26659645
  2. Study showed that maternal exposure to chronic footshock stress increases the intensity of diazepam withdrawal symptoms and significantly reduce levels of 5HT1A receptors in the raphe nuclei of adult offspring, suggesting that prenatal stress may increase vulnerability to drugs PMID: 27235743
  3. Microdialysis data support the interpretation that NLX-112 reduces l-DOPA-induced abnormal involuntary movements via serotonin 5-HT1A receptor activation leading to blunting of the l-DOPA-induced elevation in striatal dopamine levels PMID: 26777281
  4. inwardly rectifying K+ channels coupled to 5-HT1A autoreceptors display pharmacological properties generally expected for neuronal GIRK channels, but different from GIRK1-GIRK2 heteromers PMID: 26460748
  5. daily repeated brief separation from pups results in increased maternal rat brain ERalpha, ERbeta, and oxytocin receptor, as well as decreased 5-HT1ARs in the dam's brain PMID: 25486578
  6. mu-opioid and 5-HT1A receptors cooperatively act to regulate escape behaviour. PMID: 25315826
  7. 5-HT1A receptors in the commissural nucleus tractus solitarii facilitate tissue perfusion after blood loss likely by increasing sympathetic-mediated venous return. PMID: 25980022
  8. Synergistic FGFR1-5HT1A interactions exist in FGFR1 signalling of the RN33B cells. PMID: 25957476
  9. a differential role of 5-HT in the acquisition and extinction of an operant conditioning task PMID: 24949809
  10. Chronic mild stress and stress during pregnancy produced the most salient changes in 5-HT1A receptor and transcription factor expression and sef specificity. PMID: 24946016
  11. 6-OHDA lesions of the SNc lead to a down-regulation of 5-HT1A receptor expression on GAD67-positive neurons. PMID: 24563117
  12. The authors determined that serotonin-reduced rats were predisposed to tramadol-induced seizures, and that serotonin concentrations were negatively associated with seizure thresholds. PMID: 25208083
  13. Study demonstrates that an acute and strong physical stress stimulus causes the reduction of the 5-HT1A receptor uptake PMID: 24771590
  14. The results indicate that 5-HT1A and 5-HT2A receptors in the dorsomedial nucleus of the hypothalamus play a phasic inhibitory role upon escape expression, as previously reported in the dorsal periaqueductal gray matter PMID: 23787365
  15. our data suggest that in addition to activation of 5-HT1A, 5-HT7 receptors may also be involved in the behavioural consequences of exposure to swim stress PMID: 24162801
  16. These results suggest a synergic interaction between the 5-HT1A and the mu-opioid receptor at post-synaptic level on neurons of the dorsal periaqueductal grey that regulate proximal defense, theoretically related to panic attacks. PMID: 23598399
  17. Induction of smooth muscle differentiation by serotonin was blocked by the knock-down of SRF and myocardin. PMID: 24595007
  18. data show that the depressive behavior observed in adulthood in this animal model may be associated with long-term alterations in the expression of the mRNA of the 5-HT1A receptors. PMID: 24211235
  19. 5-HT1A receptors in the MRN-hippocampus pathway is a key component for gender-specific emotional regulation and may be a cause of psychiatric disorders associated with vulnerability or resistance to emotional stress. PMID: 24599137
  20. The serotonin-5-HT1A receptor pathway that modulates the amygdala function might play a certain role in the development and treatment of behavioral symptoms exhibited in rat valproate-induced autism model. PMID: 23823694
  21. Agonist-induced 5-HT1A receptor internalization does exist in neurons and depends on neuronal phenotype. PMID: 24381289
  22. Role of 5HT1A in urethral smooth muscle varies between sexes PMID: 24049146
  23. Brain 5-HT1A receptors suppress defensive aggression in rats. PMID: 23299041
  24. Expression of 5-HT1AR in the oculomotor nucleus neurons gradually increased during 7 days after exposure to single-prolonged stress. PMID: 22930314
  25. A rat recombinant 5-HT(1A) R was extracted from the tsA201 cell line, run using several gel-based principles with subsequent in-gel digestion with several proteases followed by nano-LC-ESI-MS/MS analysis on ion trap and an LTQ Orbitrap Velos. PMID: 22997067
  26. This study demonistrated that significantly decreased 5-HT(1A) protein level in bed nucleus of the stria terminalis. PMID: 22922122
  27. This finding has lent support to reports that diverse partial agonists for 5-HT(1A) receptors exert high sensitivity for presynaptic components. PMID: 22880045
  28. In a complex including Yif1B and Rab6, with Kif5B and dynein as two opposite molecular motors, 5-HT1AR coordinates vesicular traffic along dendritic microtubules. PMID: 23055492
  29. Overall, the present data suggest a preferential action of (+/-)8-OH-DPAT on 5-HT1AR in GABAergic interneurons. PMID: 21893679
  30. GPR30 is necessary for estradiol-induced changes in the 5-HT(1A) receptor signaling pathway and desensitization of 5-HT(1A) receptor signaling. PMID: 22265196
  31. CBD can act in the BNST to attenuate aversive conditioning responses and this effect seems to involve 5-HT(1A) receptor-mediated neurotransmission. PMID: 21148020
  32. 5-HT(1A) receptors inhibit CA3-CA1 synaptic transmission acting both pre- and postsynaptically, whereas 5-HT(7) receptors enhance CA3-CA1 synaptic transmission acting exclusively at a postsynaptic site. PMID: 21538661
  33. endogenous activation of serotonergic 5HT1A receptors diminishes glutamatergic neurotransmission to cardiac vagal neurons following hypoxia and hypercapnia PMID: 21930251
  34. Data show that during epileptogenic periods following hypoxic-ischemia, both 5-HT(1A) and 5HT(1B) receptor immunoreactivities were decreased within the lesioned and the non-lesioned hippocampus. PMID: 21681557
  35. Data suggest that cardiovascular responses to stress are mediated by the nucleus raphe pallidus and likely involve 5HT1A and GABA A receptors. PMID: 21982918
  36. A prevailing model of rapid eye movement (REM) sleep generation indicates that activation of 5-HT1A receptor-responsive neurons contributes significantly to the generation of REM sleep by restraining respiratory rate and motor activities. PMID: 22302804
  37. Bilateral administration of 5HT(1A) receptor agonist, 8-OH-DPAT into the medial prefrontal cortex decreased maze exploration indicating an anxiogenic response. NAN-190 reversed this, indicating a role for 5HT1A in anxiety behavior. PMID: 21982809
  38. The opposing effects of serotonin, mediated by distinct 5-HT receptors, could explain why drugs targeting serotonin function can cause either diabetes or hypoglycemia in humans. PMID: 22106156
  39. Data show that electroacupuncture activates supraspinal serotonin neurons to release 5-HT, which acts on spinal 5-HT1AR but not 5-HT2CR to inhibit hyperalgesia. PMID: 21556842
  40. Downregulation of postsynaptic 5-HT1A receptors may further exacerbate the severity of epilepsy-associated depression. PMID: 21346733
  41. Efficient coupling of the 5-HT1A receptor and G-proteins is necessary to detect different regulation by divalent magnesium- chloride (MgCl2) ion and divalent manganese chloride (MnCl2) ion. PMID: 21126535
  42. Activation of 5-hydroxytryptamine-1A receptors suppresses cardiovascular responses evoked from the paraventricular nucleus. PMID: 21753144
  43. 5-HT1A receptors are upregulated in the cerebrovasculator via a B-Raf-sensitive signaling pathway. PMID: 21223556
  44. Uncontrollable stressors produce a desensitization of dorsal raphe nucleus 5-HT1A autoreceptors, which is responsible for the behavioral consequences of uncontrollable stress. PMID: 21976495
  45. Changes in the expression of 5-HT1AR in the DR of rats after single-prolonged stress that may reveal part of the pathogenesis of post-traumatic stress disorder, were investigated. PMID: 21720713
  46. These results suggest that the distinct behavioral states produced by nicotine exposure and withdrawal correlate with reciprocal rostral-caudal patterns of activation and 5-HT1A receptor-mediated inhibition of dorsal raphe 5-HT neurons. PMID: 21501256
  47. Excitatory effect of 5-HT1A receptors on neurons may be produced by preventing the inhibitory action of the GABAergic interneuron on the projection neurons. PMID: 20813144
  48. Effects of 5-HT1 and 5-HT2 serotonin receptors on anxiety- and depression-like behavior in female rats PMID: 21598629
  49. The relationship between the activity of the 5-HT1A receptor and amygdala neuronal apoptosis, was investigated. PMID: 21468566
  50. Serotonin modulates the treatment of spatial information by the septal area through a 5-HT1A-mediated mechanism. PMID: 20959966

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite.
Protein Families
G-protein coupled receptor 1 family, 5-hydroxytryptamine receptor subfamily, HTR1A sub-subfamily
Tissue Specificity
Detected in hypothalamus, mesencephalon, amygdala, medulla, thalamus, septum and hippocampus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×