Recombinant Rat B2 bradykinin receptor(Bdkrb2)

Code CSB-CF002652RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25023
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MDTRSSLCPKTQAVVAVFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIANNFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLLPLSIITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTLLRLGVLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGGCMGESVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ
Source in vitro E.coli expression system
Gene Names Bdkrb2
Protein Names Recommended name: B2 bradykinin receptor Short name= B2R Short name= BK-2 receptor
Expression Region 1-396
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB2 sub-subfamily
Tissue Specificity Uterus, vas deferens, kidney, ileum, heart, testis, lung and brain.
Database Links

KEGG: rno:25245

STRING: 10116.ENSRNOP00000064990

UniGene: Rn.9845

Pathway Calcium signaling pathway
Regulation of actin cytoskeleton
Complement and coagulation cascades
cGMP-PKG signaling pathway
Sphingolipid signaling pathway

Related Products

Bdkrb2 Proteins

Bdkrb2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.