Recombinant Rat C-C chemokine receptor type 5 (Ccr5)

Code CSB-CF004844RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ccr5; Cmkbr5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; MIP-1 alpha receptor; CD antigen CD195
Species
Rattus norvegicus (Rat)
Expression Region
1-354
Target Protein Sequence
MDFQGSIPTYIYDIDYSMSAPCQKVNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC KKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFF IILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTC SPHFLHIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIF AIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYA FVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Gene References into Functions
  1. The data of this study demonstrated that CCR5 is correlated with up-regulation of the expression of ROCK2 and P-MLC2(Ser19) in the ischaemia cortex PMID: 26983670
  2. Spinal CCR5 is up-regulated in a model of cancer-induced bone pain. PMID: 27848062
  3. fatigue upregulates the level of ORM1, which in turn functions as an anti-fatigue protein to enhance muscle endurance via the CCR5 pathway. PMID: 26740279
  4. Local electroporation of anti-CCR5 siRNA into the left inflamed joints could achieve the silencing of CCR5 gene and alleviate local inflammation just in the knee joint PMID: 25300256
  5. Expression levels of CCR5 mRNA in the spinal cord are up-regulated after nerve injury. PMID: 24589480
  6. Blocking CCR5 attenuates, while enhancing CCR5 aggravates myocardial ischemia-reperfusion injury through modulating inflammatory responses in rat heart. PMID: 23456481
  7. Early and persistent up-regulation of CCL4/CCR5 signaling during epileptogenesis suggests that CCL4 signalling, rather than CCL2 signalling, could have a role in the epileptogenic process. PMID: 22353418
  8. Decrease in CCR5 in circulating cells strongly protected from excitotoxin-induced seizures, blood-brain barrier leakage, CNS injury, and inflammation, and facilitated neurogenic repair. PMID: 20940264
  9. CCR5 and CXCR4 are present on the resident testicular macrophages in the interstitial space PMID: 11994538
  10. Down-regulation of constitutively expressed surface CCR5 levels by interleukin 1-beta in an insulin-producing model system implies receptor internalization for re-utilization or destruction, secretion or both. PMID: 12004163
  11. CCR5 is phosphorylated at specific sites by protein kinase C and GPCR kinase PMID: 12403770
  12. Cultured neural progenitor cells from the subventricular zone of adult rat brain express chemokine receptor CCR5. PMID: 14732474
  13. CCR5 mediates recruitment of both infiltrating macrophages and resident microglia to sites of central nervous system inflammation. PMID: 17484785

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1