Recombinant Rat C-X-C chemokine receptor type 2 (Cxcr2)

Code CSB-CF011673RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cxcr2; Il8rb; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Species
Rattus norvegicus (Rat)
Expression Region
1-359
Target Protein Sequence
MGEIRVDNFSLEDFFSGDIDSYNYSSDPPFTLSDAAPCPSANLDINRYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKV FSFLQEITFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCITMWFLSLVLSLPIF ILRTTVKANPSTVVCYENIGNNTSKWRVVLRILPQTYGFLLPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNIVLFTDTLMRTKLIKETCERQNEINKALEATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGSSSANTSTTL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. These data are concomitant with abnormal cerebral CXCL1/CXCR2 expression, and support temporal aberrations in CXCL1/CXCR2 and neutrophil dynamics in the placental-fetal-brain axis following chorioamnionitis PMID: 29117499
  2. The mRNA and protein levels of CXCR2 were significantly increased in the pulmonary tissue in a rat model of hepatopulmonary syndrome. PMID: 27879294
  3. Findings indicated that up-regulation of CXCL1 and CXCR2 might contribute to remifentanil-induce hypernociception via modulating spinal NR2B-containing NMDA receptor expression and phosphorylation in rats. PMID: 26724371
  4. GRK6 might be a key molecular involved in peripheral mechanism of neuropathic pain and that overexpression of GRK6 might be a potential strategy for treatment for neuropathic pain through inhibition of CXCR2 signal pathway. PMID: 27145805
  5. Findings indicate that acupuncture can increase the number of implanted embryos in embryo implantation failure, which may be relevant with up-regulation the expression of CXCL8 receptors CXCR1 and CXCR2 in endometrium. PMID: 24496685
  6. These data suggests an important role for CXCR2 receptors in oral squamous cell carcinoma. PMID: 21670971
  7. IL8RA-endothelial cells (EC), IL8RB-EC, and IL8RA/IL8RB-EC treatment reduces neointima formation dramatically in carotid artery endothelial cells at 28 days after injury. PMID: 22361324
  8. Inhibition of CXCR1 and CXCR2 chemokine receptors is an effective anti-inflammatory and neuroprotective treatment after spinal cord injury. PMID: 20877331
  9. These data suggest that CXCR2 overexpression in peripheral T cells is intracerebral microglial TNF-alpha-dependent and TNF-alpha primes T cells transendothelial migration in Alzheimer's diseases. PMID: 18462836
  10. data show that TII alveolar epithelial cells produce three of the major proinflammatory CXC chemokines (GRO, CINC-2alpha, and MIP-2) and their cognate receptor CXCR2 PMID: 12829448
  11. A specific CXCR2 antagonist, SB-332235, effectively inhibited cigarette smoke-induced neutrophilia in a dose-dependent manner. PMID: 15516486
  12. Neuronal CXCR2 immunoreactivity was detected in several brain areas, which rapidly but transiently downregulated upon trauma. PMID: 16472549
  13. These findings highlight the contribution of CXCR2 in the pathophysiology of adjuvant-induced polyarthritis (AIA) PMID: 17891165
  14. CXCR2 activation might directly contribute to motor neuron degeneration PMID: 18391506
  15. Results suggest that the CXCR2 and PI3Kgamma signaling pathway may represent a suitable target for the development of novel therapeutic strategies for human diseases characterized by vascular leakage. PMID: 19255141

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1