Recombinant Rat Endothelin B receptor (Ednrb)

Code CSB-CF007404RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ednrb
Uniprot No.
Alternative Names
Ednrb; Endothelin receptor type B; ET-B; ET-BR; Endothelin receptor non-selective type
Species
Rattus norvegicus (Rat)
Expression Region
27-442
Target Protein Sequence
EKRGFPPAQATPSLLGTKEVMTPPTKTSWTRGSNSSLMRSSAPAEVTKGGRVAGVPPRSF PPPCQRKIEINKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALG DLLHIIIDIPINAYKLLAGDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASW SRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDVITSDYKGKPLRVCMLNPFQKTAFM QFYKTAKDWWLFSFYFCLPLAITAIFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVF CLVLVFALCWLPLHLSRILKLTLYDQSNPQRCELLSFLLVLDYIGINMASLNSCINPIAL YLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-specific receptor for endothelin 1, 2, and 3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. high glucose upregulated ETB receptors by downregulating Sirt1 and subsequently activating the ERK1/2 signaling pathways in the organ culture superior mesenteric arteries . PMID: 29115394
  2. The results presented herein show that ETB receptors (R) have much weaker Ca(2+)-sensitizing effect than ETA-R and that ETB-R appear to be more dependent on Ca(2+) influx presumably through voltage-gated Ca(2+) channels (VGCC). PMID: 28757442
  3. the mRNA expression of prepro-endothelin-1 (ppET-1), as well as that of the ETA and ETB receptors, were quantified by real-time PCR in these veins... exercise training mobilizes endothelin-1 (ET-1) to reinforce the Ang II-induced responses mainly through ETA activation PMID: 28012855
  4. Denervation reduced mean arterial pressure in ETB-deficient rats compared with sham-operated controls, however denervation did not affect the increase in blood pressure after 2 wk of high-salt diet. Denervation reduced cardiac sympathetic-to-parasympathetic tone [low frequency-high frequency (LF/HF)] during normal salt diet and vasomotor LF/HF tone during high-salt diet in ETB-def rats. PMID: 28701323
  5. Expression of smooth muscle proteins and both ETA and ETB by the endovascular trophoblast enable it to contract upon activation of both receptors by ET1. PMID: 27697218
  6. Data analyses strongly suggest that the identified deletion in the intergenic region upstream of Ednrb, which might contain a melanocyte-specific enhancer, is the mutation causative of the head spot phenotype in the KFRS4/Kyo rat strain. PMID: 28356074
  7. Used Western blots to characterize antibodies targeted to the N or C terminal and the second or third intracellular loop of the endothelin B receptor (ETB). The IL2-targeted antibody accurately detected endogenous ETB expression in brain and cultured astrocytes by labeling a 50-kDa band, the expected weight of full-length ETB. PMID: 25232999
  8. These findings demonstrate that diurnal excretion of an acute salt load 1) requires ET-1 and the ETB receptor, 2) is more evident in male vs. female rats, and 3) is opposed by the ETA receptor. PMID: 27582096
  9. Results suggest that endothelin receptor B (EDNRB) mutation reduces cell proliferation and increases apoptosis in the hippocampal formation of the spotting lethal rat, but does not alter the levels of brain derived neurotrophic factor and glial cell line-derived neurotrophic factor. Our findings provide an insight into the cellular changes in the brains of Hirschsprung's disease patients caused by EDNRB mutation. PMID: 27017960
  10. both ETA and ETB receptor expression in the renal cortex were significantly attenuated by ovariectomy, and this reduction was not evident in OVX+E2 rats. SIGNIFICANCE: These data suggest that ovarian hormones regulate ET receptor expression and may contribute to sex differences in cardiovascular and renal health. PMID: 26776836
  11. a modified locus on Chromosome 7 was mainly responsible for the variance of pigmentary disorder between AGH-Ednrb(sl) rats and LEH-Ednrb(sl) rats, and two modifier loci showing epistatic interaction may, in part, influence pigment phenotype. PMID: 26796131
  12. Confirm the presence of ETA-ETB receptor cross-talk in the rat basilar artery. PMID: 26528589
  13. Results indicate that ETB receptors appear to play a role in the development of the central nervous system PMID: 25806822
  14. Results suggest that status epilepticus-induced ETB receptor/eNOS-mediated MMP-9 activation may lead to impairments of endothelial cell function via tight junctions protein degradation PMID: 26232046
  15. data suggest that ET receptors may be an important actor in diabetes-related liver damage. PMID: 24918345
  16. Findings indicate that the endothelin B receptor may be a novel therapeutic target for Alzheimer's disease and other neurovascular degenerative disorders. PMID: 26022359
  17. Physiologically relevant concentrations of ET-1/ET-3 did not modulate ET-B receptor function. PMID: 25891848
  18. Data show that the protein expression of the endothelin receptors ETA and ETB was significantly elevated in male growth-restricted offspring. PMID: 26459423
  19. Endothelin-B receptors modulate sympathetic activation during acute myocardial infarction not only in the ventricular myocardium, but also in the adrenal gland. PMID: 24503339
  20. The aim was to quantify the density of ETA and ETB receptors in cardiopulmonary tissue from pulmonary arterial hypertension patients and the monocrotaline (MCT) rat. PMID: 24582810
  21. ETB receptors in the cerebral cortex and subventricular zones of the brain decrease with age. PMID: 24815227
  22. Enhanced vascular expression of ETB receptors contributes to augmented ROS production, endothelial dysfunction and increased vasoconstriction in erectile tissue from insulin-resistant obese rats. PMID: 25091502
  23. Mitogen-activating protein kinases (ERK1/2 and p38) and the downstream transcriptional factor NF-kappaB pathways were involved in cyclosporin A-induced upregulation of ETB receptor in arterial smooth muscle cells. PMID: 25772258
  24. Renal expression of Ednrb correlated with captopril-induced blood pressure effects. PMID: 24779608
  25. Heart ischaemia-reperfusion induces local up-regulation of vasoconstrictor endothelin ETB receptors in rat coronary arteries downstream of occlusion. PMID: 24467585
  26. These findings identify a novel mechanistic interaction between the ET-1/ETB receptor axis and CX3CL1/CX3CR1 in mediating pulmonary angiogenesis and vascular monocyte accumulation in experimental HPS. PMID: 24731444
  27. Downregulation of microvascular endothelial type B endothelin receptor is a central vascular mechanism in hypertensive pregnancy. PMID: 24914193
  28. Data from in vitro study on mesenteric microvessels suggest that up-regulation of endothelial ETBR/Ednrb (not ETAR/Ednra) contributes to enhanced microvascular relaxation, decreased vasoconstriction, and reduced vascular resistance during pregnancy. PMID: 23646960
  29. ETB receptors contribute to contraction and are coupled to the augmented ET-1 induced calcium signaling response under conditions of insulin resistance. PMID: 23875673
  30. Report effect of antidiabetic agents on endothelin receptor subtype(s) regulation/binding in type 1 diabetic rat hearts. PMID: 24144054
  31. The enhanced ETBR-mediated microvascular relaxation may contribute to the decreased vasoconstriction and vascular resistance during pregnancy. PMID: 23646960
  32. C-terminus of ETA/ETB receptors regulate endothelin-1 signal transmission. PMID: 23436727
  33. ET-3 at low concentrations may attenuate inflammatory responses via ETB2 activation and nitric oxide production PMID: 23370722
  34. The results suggest that the ET(A)/ET(B) receptors play an important role in cerebral vasospasm after subarachnoid hemorrhage PMID: 23351051
  35. In rat trigeminal ganglion neurons, ETB activation leads to Ca2+ mobilization, a special feature in the trigeminal system. ETB-mediated Ca2+ responses occurred most frequently in neurons that were capsaicin-insensitive. PMID: 23396520
  36. Expression and contractile functions of ET(B) and 5-HT(1B) receptors were strongly upregulated and slightly downregulated, respectively, 24 h after experimental stroke. PMID: 22585122
  37. Endothelin-1 acts in an intracrine fashion on endolysosomal ET(B) to induce nitric oxide formation, thus modulating endothelial function PMID: 23086942
  38. Data indicate that mmLDL upregulates the endothelin type B (ET(B)) receptors in coronary artery, mainly via activation of the ERK1/2 MAPK and the downstream transcriptional factor NF-kappaB. PMID: 22198514
  39. The Ednrb null rats showed a low white blood cell count, significant size reduction and abnormal microarchitecture of spleen. PMID: 22975636
  40. Elevated intraocular pressure mediated increase in ET(B) receptor expression and its activation may contribute to a decrease in RGC survival as seen in glaucoma. PMID: 22916224
  41. Coronary arteries rapidly upregulate vasocontractile ETB receptors during organ culture via transcriptional mechanisms and MEK-ERK1/2 signalling. This model may mimic the mechanisms seen in ischemic conditions PMID: 22391414
  42. Our results demonstrated that ETA-R blockage is more effective in inhibiting free radical generation and improving heart antioxidant properties than ETB-R blockage under oxidative stress. PMID: 23047940
  43. Our findings demonstrate that aldosterone modulates an ET(B) cysteinyl thiol redox switch to decrease pulmonary endothelium-derived NO(.) and promote pulmonary arterial hypertension. PMID: 22787113
  44. endothelin can engage ET-B already highly concentrated in caveolae of endothelial cells to induce very rapid caveolae fission and endocytosis PMID: 22457360
  45. ET(A)-ET(B) receptor cross-talk is present in the rat basilar artery PMID: 22258095
  46. Minimally modified LDL upregulates ET(B) receptors of cerebral basilar artery via the PKC, MAPK and NF-kappaB signal pathways. PMID: 22198335
  47. Increased expression of endothelin receptor B in neurons and glia could be related to a more generalized activation of survival mechanisms involving elements of the neurovascular unit. PMID: 21801590
  48. ET(B) receptor activation in supraoptic nucleus astrocytes induces the mobilisation of [Ca(2+) ](i) , likely resulting in the activation of glutamate and nitric oxide signalling pathways. PMID: 22007724
  49. Data found that the null mutation of the Ednrb gene, thought indispensable for enteric neuron development, is insufficient to result in HSCR disease when bred onto a different genetic background in rats carrying Ednrb(sl) mutations. PMID: 21915282
  50. ET-1 acts as an anti-apoptotic factor on olfactory sensory neurons, directly through ETB and indirectly by limiting non neuronal cells death through ETA. PMID: 21035524

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRB sub-subfamily
Tissue Specificity
Widely distributed in cell types of a variety of tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1