Recombinant Rat G protein-activated inward rectifier potassium channel 2 (Kcnj6)

Code CSB-CF012059RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Kcnj6; Girk2; Kcnj7; G protein-activated inward rectifier potassium channel 2; GIRK-2; BIR1; Inward rectifier K(+ channel Kir3.2; KATP-2; Potassium channel, inwardly rectifying subfamily J member 6
Species
Rattus norvegicus (Rat)
Expression Region
1-425
Target Protein Sequence
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP KEELEIVVILEGMVEATGMTCQARSSYVTSEILWGYRFTPVLTLEDGFYEVDYNSFHETH ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE NESKV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This potassium channel is controlled by G proteins. It may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium or cesium.
Gene References into Functions
  1. The opening of ATP-sensitive K+ channels protects cardiomyocytes against the high glucose-induced injury and inflammation by inhibiting the ROS-TLR4-necroptosis pathway. PMID: 28291959
  2. inwardly rectifying K+ channels coupled to 5-HT1A autoreceptors display pharmacological properties generally expected for neuronal GIRK channels, but different from GIRK1-GIRK2 heteromers PMID: 26460748
  3. Fourteen days after axotomy, GIRK1 and GIRK2 were down-regulated in DRG neurons at the mRNA and protein levels. PMID: 26199148
  4. Data describe the developmental regulation and subcellular diversity of neuronal GIRK/Kir3 channels, and support the contention that distinct subpopulations of GIRK channels exert separable influences on neuronal excitability. PMID: 22098295
  5. Estradiol regulates dopamine-activataed GIRK channel activity in pituitary lactotrophs, regulating prolactin release during the estrous cycle. PMID: 21653876
  6. The mutant, Gbeta1(W332A) protein, although inactive, retains its ability to bind Kir3 and prevents the wild type Gbeta from activating the channel. PMID: 16797547
  7. the KCNJ6 rs2070995 AA genotype association with increased opioid requirements extends from analgesia to opiate substitution therapy PMID: 20220551
  8. Galpha(q) interacted with N termini of Kir3.1, Kir3.2, and Kir3.4. However, Galpha(q) did not interact with the C terminus of any Kir3 PMID: 17296805
  9. Data describe localization of GIRK1, GIRK2, and GIRK3 subunits and 5-HT(1A) receptor in rat brain, and their co-expression with markers of glutamatergic, gamma-aminobutyric acid (GABA)ergic, cholinergic, and serotonergic neurons PMID: 18698588
  10. NMDA receptor activation in cultured dissociated hippocampal neurons elevates surface expression of the GIRK channel subunits GIRK1 and GIRK2 in the soma, dendrites, and dendritic spines PMID: 19118198
  11. GIRK2 null mutation abolishes depotentiation of long-term potentiation PMID: 19118199

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ6 subfamily
Tissue Specificity
Pancreatic beta cells and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1