Recombinant Rat Gastrin/cholecystokinin type B receptor (Cckbr)

Code CSB-CF004773RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cckbr; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Species
Rattus norvegicus (Rat)
Expression Region
1-452
Target Protein Sequence
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. CCK-B receptors mediate acetylcholine release through cell bodies of cholinergic interneurons in the corpus striatum. PMID: 22981453
  2. CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen production PMID: 20843811
  3. Pancreatic islet CCK1/2 receptors initiate somatosatin secretion through constitutive secretion controlled at the level of protein synthesis. PMID: 19959964
  4. CCK(B) receptor mediates synergistic stimulation of DNA synthesis and cyclin expression PMID: 11748587
  5. These results indicate that CCKB, but not CCKA receptors are involved in anxiety, as tested by microinjection of cholecystokinin agonists. PMID: 12373548
  6. Genetic variations in CCK2 receptor in PVG hooded and Sprague-Dawley rats and its mRNA expression on cat exposure PMID: 12708535
  7. CCK-AR and CCK-BR gene were present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells and alveolar epithelial cells, which play an important role in mediating the regulatory actions of CCK-8 on these cells. PMID: 12800239
  8. gastrin increased PGE2 secretion in Swiss 3T3 cells expressing the CCK2 receptor PMID: 12891702
  9. the data identified CCK-A and CCK-B receptor mRNAs in the rat retina and demonstrated that they are functional, stimulating tyrosine phosphorylation pathways. PMID: 14698681
  10. Insulin can negatively control pancreatic somatostatin mRNA and hormone content and positively control CCK(B)R mRNA; the CCK(B)R protein appears to be delayed. PMID: 15161757
  11. analysis of interspecies polymorphism in the human and rat cholecystokinin receptor-2 and its effect on the cholecystokinin binding site PMID: 15817487
  12. The present results substantiate the view that dorsolateral periaqueductal gray CCK(2) receptors modulate panic-related behaviors. PMID: 16168394
  13. under 'basal' conditions, a portion of the glandular protein synthesis, as well as the whole increase in synthesis in response to administration of pentagastrin, engaged both types of CCK receptors. PMID: 16556659
  14. CCK(2) receptors located in the peraqueductal gray are involved in the regulation of panic-related behaviors and may mediate the effect of cholecystokinin-4 on panic. PMID: 17498673
  15. Functional postsynaptic G-protein-coupled CCK B receptors are prevalent in neonatal rodent spinal cord. PMID: 17581850
  16. CCK modulates glutamate-GABA mechanisms by acting on CCK-2 receptors via volume transmission occurring at basolateral amygdaloid nucleus and/or by synaptic or perisynaptic volume transmission in rostrolateral main and paracapsular intercalated islands. PMID: 18088282
  17. Our data indicate that CCK, acting via CCK(B) receptors, produces a long-lasting excitation of layer 6b neocortical neurons, and this action may play a critical role in modulation of corticothalamic circuit activity. PMID: 19497313

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Parietal cells, pancreas, brain and various neoplastic tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1