Recombinant Rat Growth hormone secretagogue receptor type 1 (Ghsr)

Code CSB-CF009416RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ghsr
Uniprot No.
Alternative Names
Ghsr; Growth hormone secretagogue receptor type 1; GHS-R; GH-releasing peptide receptor; GHRP; Ghrelin receptor
Species
Rattus norvegicus (Rat)
Expression Region
1-364
Target Protein Sequence
MWNATPSEEPEPNVTLDLDWDASPGNDSLPDELLPLFPAPLLAGVTATCVALFVVGISGN LLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQF VSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVL VGVEHENGTDPRDTNECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWR RRGDAAVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQISQ YCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFESFSQRKLSTLKDESSRAWTKS SINT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
Gene References into Functions
  1. Present findings along with previous results support the idea that ghrelin/growth hormone secretagogue receptor 1a signaling in the lateral amygdala circuit blocks conditioned taste aversion. PMID: 29254662
  2. GHS-R1a expression from rats with and without ligature-induced periodontitis was analyzed by real-time PCR, immunocytochemistry, and immunofluorescence. PMID: 29317796
  3. GHSR expression in primary neurons is not only modulated in a time-dependent manner but also that there might be a selective regional distribution which might yield to functional modulatory effects of ghrelin in the brain areas. PMID: 28409695
  4. Fasted FHH-GHSR(m1/Mcwi) rats exhibited increased Agouti-Related Peptide (AgRP) and Neuropeptide Y (NPY) expression in the Arcuate Nucleus (ARC), indicative of altered central regulation of feeding and energy balance PMID: 27129673
  5. Data show that growth hormone secretagogue receptor Ghsr(Q343X) mutation (Ghsr(M/M)) rats had a more stable body weight under caloric restriction. PMID: 27095593
  6. Study demonstrated that NMDAR functions are regulated by ghrelin in a GHSR1a-dependent manner: NMDAR-mediated synaptic currents are increased as a result of GluN1 subunit phosphorylation in the hippocampal pyramidal neurons and synapses PMID: 26490687
  7. The present study aimed to investigate the expression of growth hormone (GH) secretagogue receptor 1a (GHSR-1a), and the association with cardiac remodeling in rats with myocardial infarction (MI). PMID: 25058156
  8. Ghrelin may act as an adjuvant to regulate gastric smooth muscle contraction induced by carbachol through GHSR1. PMID: 25230765
  9. These results suggest that ghrelin exerts an antiapoptotic effect on AMs at least partly by inhibiting JNK and activating the Wnt/beta-catenin pathway and thereby helps alleviate septic respiratory distress in rats. PMID: 25337654
  10. Ghrelin secretagogue receptors (GHS-R1A) appear to be involved in the opioid-induced changes in the mesolimbic dopaminergic system associated with the reward processing. PMID: 24531567
  11. These data suggest that ghrelin receptor-deficient rats leads to an early onset decrement in hippocampal structural integrity that may manifest in non- spatial-related behavioral deficits. PMID: 24525421
  12. In a model of neuropathic pain and chronic constriction injury, GHSR-1a expression is significantly downregulated. PMID: 24513955
  13. Intrarenal ghrelin receptors in the cortical collecting duct regulate ENaC-dependent sodium reabsorption by a cAMP-dependent pathway. PMID: 23698230
  14. Data suggest that high-fat diet (HFD) increases the constitutive activity of renal ghrelin receptor (GHSR) to increase Na(+) reabsorption and induce hypertension in rats. PMID: 24797629
  15. GHSR-positive neurons were observed in the gustatory rostral nucleus tractus solitarius and in areas involved in vestibulo-ocular processing (such as the medial vestibular nucleus and the nucleus abducens). PMID: 23348715
  16. GHS-R is expressed in primary neurons and its expression is dependent upon their developmental stage and shows differences according to the brain region involved. PMID: 23755116
  17. Data suggest that ghrelin/Ghsr signal transduction is involved in neurogenesis; investigation studies involvement in proliferation of adult hippocampal neural stem cells in primary culture; addition of ghrelin increases Ghsr/GHS-R1a protein level. PMID: 23608221
  18. Down regulation of ghrelin receptors in small intestine muscle layers may contribute to the occurrence of small intestine dysmotility after intestinal surgery. PMID: 21713709
  19. Results suggest that GHR-R activity is required for the induction of locomotor sensitization to cocaine. PMID: 21790898
  20. This study investigated whether ghrelin has direct vasodilator effects mediated through the growth hormone secretagogue receptor 1a (GHSR1a) and whether ghrelin reduces sympathetic nerve activity. PMID: 22886413
  21. GSHR1A antagonists reduce food intake and body weight gain in rats. PMID: 22537050
  22. Using ghrelin receptor and leptin-deficient mice, data show that ghrelin has dual effects on osteoclastogenesis, inhibiting osteoclast progenitors directly and stimulating osteoclastogenesis via a more potent systemic/central pathway. PMID: 22700774
  23. These results suggest epigenetic modifications at GHSR to play important roles in determining GHSR1A expression and abundance, and therefore the consequent sensitivity of cells to ghrelin. PMID: 21756973
  24. Rats with chronic renal failure showed a significantly higher expression of GHSR in the gastric fundus but significantly lower expression in the hypothalamus and duodenum than controls. PMID: 21269967
  25. Results indicate that continuous antagonism of the ghrelin receptor results in early induction of salt-sensitive hypertension and suggests that increases in autonomic nervous activity induced by ghrelin receptor antagonism are responsible. PMID: 20596792
  26. Rat peritoneal mast cells and rat basophilic leukemia (RBL-2H3) cells did not express the ghrelin receptor GHSR1a, suggesting that histamine release induced by ghrelin occurs via a receptor-independent mechanism. PMID: 20691233
  27. Data describe effects of activity-based anorexia on muscle and fat depots by studying ghrelin and leptin receptors. expression. Although PMID: 20600421
  28. it is concluded that ghrelin receptors are expressed by lumbosacral autonomic preganglionic neurons of the micturition reflex pathways PMID: 20497419
  29. The first evidenced GHSR-1a in cytoplasm of spermatocytes, cell membrane and acrosomes of spermatids, Sertoli cell processes and heads of spermatozoa. PMID: 20164026
  30. Growth hormone-releasing peptide 6 partially reverses glutamate-induced cell death but not the activation of caspases, suggesting blockage of the caspase-independent cell death pathway. PMID: 19490089
  31. GHS-R1a disappears in some tissues, such as skin, close to and just after birth, accompanied by disappearance of the effects of ghrelin and des-acyl ghrelin on cell proliferation. PMID: 20152815
  32. Hexarelin and ghrelin activate phospholipase C and protein kinase C signaling cascade through the stimulation of the GHS-R. PMID: 20056829
  33. Hypothalamic growth hormone secretagogue receptor regulates growth hormone secretion, feeding, and adiposity PMID: 12045256
  34. Review. This review will summarize data regarding the structure of the GHS-R gene and the protein encoded, reports investigating the expression and control of the GHS-R in various tissues, and studies of the underlying transcriptional mechanisms. PMID: 12511847
  35. The growth hormone secretagogue receptor is expressed in the rat adrenal cortex. PMID: 12586359
  36. expression of growth hormone secretagogue receptor in rat adipocytes increases with the age and during adipogenesis PMID: 12586750
  37. expression of total GHS-R was detected at certain stages of postnatal development and spermatogenic cycle, thus raising the possibility that, the balance between receptor subtypes may represent a novel mechanism of ghrelin sensitivity in rat testis PMID: 12606422
  38. Growth hormone secretagogue receptor is expressed in neuronal cells of the nucleus of the solitary tract & the dorsal motor nucleus of the vagus. Ghrelin acts through this receptor to suppress sympathetic activity & to decrease arterial pressure in rats. PMID: 14993197
  39. GHSR-1a expression is upregulated and vascular sensitivity to ghrelin stimulation is increased in the hyperdynamic phase of sepsis. PMID: 15155262
  40. the level of GHS-R expression in the ARC is reduced by leptin and increased by ghrelin and that the effect of ghrelin may be GH dependent PMID: 15448083
  41. Results indicate that insulin-like growth factor-I could inhibit growth hormone secretion at least in part by regulating the expression of the ghrelin receptor. PMID: 15680488
  42. The mechanisms by which ghrelin modifies food intake remain to be defined and may involve a novel GHS receptor PMID: 15919752
  43. Ghrelin therefore appears to directly potentiate adipocyte insulin-stimulated glucose uptake in selective adipocyte populations. Ghrelin may play a role in adipocyte regulation of glucose homeostasis PMID: 16338009
  44. the growth hormone secretagogue receptor does not have a role in des-acyl ghrelin increase of food intake PMID: 16484324
  45. activation of ghrelin receptors in the lumbo-sacral spinal cord triggers co-ordinated propulsive contractions that empty the colo-rectum PMID: 16873401
  46. Results show that a cell line derived from a rat anterior pituitary adenoma, RC-4B/C, expresses endogenous growth hormone secretagogue receptor as judged by reverse transcriptase-PCR. PMID: 16901923
  47. Study show that central ghrelin receptors are involved in ghrelin sympathoinhibitory properties. PMID: 17911350
  48. GH-secretagogue receptor mRNA expression and the GH response to a bolus i.v. injection of exogenous ghrelin were largely unaffected during pregnancy. PMID: 18208550
  49. Expression of GHSR-1a and NPY was not changed after short term treadmill exercise. PMID: 18389390
  50. During periods of energy insufficiency, exposure to acylated ghrelin may limit energy utilization in specific white adipose tissue depots by GHS-R(1a)-dependent lipid retention. PMID: 19299444

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1