Recombinant Rat Leukocyte surface antigen CD47 (Cd47)

Code CSB-CF004940RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Species
Rattus norvegicus (Rat)
Expression Region
19-303
Target Protein Sequence
QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTRE QNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGAILFIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Plays an important role in memory formation and synaptic plasticity in the hippocampus.
Gene References into Functions
  1. down-regulation of CD47 exerts a protective effect against myocardial I/R injury, which may be attributable to attenuation of oxidative stress via activation of the eNOS/nitric oxide signaling pathway. PMID: 27960187
  2. CD47 blockade with CD47mAb400 administered both to the donor and the recipient reduced liver graft ischemia reperfusion injury in a rat liver transplantation model. PMID: 25482981
  3. IAP2 overexpression in neural stem cells induced neuronal differentiation. PMID: 25706387
  4. The CD47-binding peptide of thrombospondin-1 induces defenestration of liver sinusoidal endothelial cells. PMID: 23799952
  5. These data reveal a novel role for CD47-mediated signaling in the control of the molecular network governing endothelial-dependent T-cell diapedesis. PMID: 23990210
  6. genetic induction of the expression of recipient CD47 on xenogeneic donor cells could provide inhibitory signals to recipient macrophages via SIPRalpha PMID: 23472187
  7. Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID: 23087362
  8. Data suggest that hyperglycemia induces increase in association of IAP with SHPS-1 (tyrosine phosphatase non-receptor type substrate-1); this appears to be a generalized response of endothelial cells that contributes to endothelial cell dysfunction. PMID: 22193512
  9. IAP plays important roles in dendritic outgrowth and synaptic transmission in developing cortical neurons through the activation of MAPK PMID: 15297459
  10. 4N1K-stimulated mast cell exocytosis involves a CD47/integrin/G(i) protein complex. PMID: 19205621
  11. Amyloid beta peptides trigger CD47-dependent mast cell secretory and phagocytic responses. PMID: 19505377

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hippocampus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1