Recombinant Rat Lysosome-associated membrane glycoprotein 2(Lamp2)

Code CSB-CF012740RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P17046
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence ALKLNLTDSKGTCLYAEWEMNFTITYEALKVNETVTITVPDKVTYNGSSCGDDKNGAKIMIQYGSTLSWAVNFTKEASQYFINNITLSYNTNDTKTFPGAVPKGILTVIIPVGSQLPLGVIFKCSSVLTFNLSPVVQHYWGIHLQAFVQNGTVSKHEQVCKEDKTATTVAPIIHTTVPSPTTTLTPTSIPVPTPTVGNYTISNGNATCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQTAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVNMYLANGSAFHVSNNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGEYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF
Source in vitro E.coli expression system
Gene Names Lamp2
Protein Names Recommended name: Lysosome-associated membrane glycoprotein 2 Short name= LAMP-2 Short name= Lysosome-associated membrane protein 2 Alternative name(s): CD107 antigen-like family member B LGP-110 LGP-96 Lysosomal membrane glycoprot
Expression Region 26-411
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live
Subcellular Location Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, autophagosome membrane
Protein Families LAMP family
Tissue Specificity Detected in liver, kidney, spleen and macrophages (at protein level).
Database Links

KEGG: rno:24944

STRING: 10116.ENSRNOP00000000177

UniGene: Rn.1722

Pathway Autophagy

Related Products

Lamp2 Proteins

Lamp2 Proteins for Rattus norvegicus (Rat)

Lamp2 ELISA Kit

Lamp2 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.