Recombinant Rat Melanin-concentrating hormone receptor 1 (Mchr1)

Code CSB-CF013584RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mchr1; Gpr24; Slc1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein
Species
Rattus norvegicus (Rat)
Expression Region
1-360
Target Protein Sequence
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for melanin-concentrating hormone, coupled to G proteins that inhibit adenylyl cyclase.
Gene References into Functions
  1. data suggest a dual role of MCH and the MCH1-R in regulation of alcohol intake, possibly through mechanisms involving caloric intake and reward motivation. PMID: 27579857
  2. MCH levels in the CSF, brain preproMCH and MCHR1 gene expression during paradoxical sleep deprivation, sleep rebound and chronic sleep restriction were studied in rats. PMID: 26456505
  3. The study identified the amino acids that are selectively involved in Gi/o activation by rat melanin-concentrating hormone receptor 1. PMID: 25617691
  4. Data indicate that Mch/Mchr1 signal transduction participates in modulation of depression-like behavior through processes in CA1 region of hippocampus. Model of depression involves chronically higher Mch expression and down-regulation of Mchr1. PMID: 22209364
  5. Diet-induced obesity and related metabolic disorders are possibly correlated with up-regulated expression of MCHR1 and down-regulated expression of OB-Rb in adipose tissue. PMID: 21946196
  6. Data suggest that MCH and its receptor (MCHR1) form an orexigenic system whose expression is affected in conditioned taste aversion. MCHR1 expression is up-regulated in hypothalamus and brain stem (and possibly amygdala) of aversive animals. PMID: 21925200
  7. The basic residues in the membrane-proximal C-terminal tail of the rat melanin-concentrating hormone receptor 1 are required for receptor function. PMID: 15117878
  8. MCH1R undergoes rapid melanin concentating hormone-induced internalization and that a portion of the C-terminal tail plays an important role in the internalization process. PMID: 15476926
  9. Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail PMID: 15590649
  10. Castration and testosterone treatment on the vasculature in the ventral prostate in adult rats and mice alter expression of this protein. PMID: 15845622
  11. These data support the notion that MIZIP might interact with elanin-concentrating hormone receptor 1 (MCHR1) in a cell type specific manner in vivo, suggesting a role in the regulation of MCH signalling in distinct regions of the mammalian brain. PMID: 15950311
  12. In nodose ganglia from rats fasted for 24 h, RT-PCR revealed the expression of both melanin-concentrating hormone and MCHR1, whereas in nodose ganglia from animals fed ad libitum expression was virtually undetectable. PMID: 16359819
  13. the results support a role of the melanin-concentrating hormone MCH(1) receptor in the regulation of deep slow-wave sleep-REM sleep cycle PMID: 18062961
  14. RGS8, which is highly expressed in the brain, functions as a negative modulator of MCH1R signaling. PMID: 18760349
  15. SNAP79441 inhibitis this receptor and reduces the micturition response in rats. PMID: 18849359
  16. data suggest that the major contribution of the DRY motif in MCH1R is to govern receptor conformation and G protein coupling/recognition PMID: 19428776

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
High level in the brain, moderate amounts in the eye and skeletal muscle, and small amounts in tongue and pituitary.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×