Recombinant Rat Mucin-4 (Muc4)

Code CSB-CF733957RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Muc4
Uniprot No.
Alternative Names
Muc4; Smc; Mucin-4; MUC-4; Ascites sialoglycoprotein; ASGP; Pancreatic adenocarcinoma mucin; Pre-sialomucin complex; pSMC; Sialomucin complex; Testis mucin
Species
Rattus norvegicus (Rat)
Expression Region
1616-2344
Target Protein Sequence
DPHITTLDNAKYTFNGLGYFLLVQAQDRNSSFLLEGRTAQTDSANATNFIAFAAQYNTSS LKSPITVQWFLEPNDTIRVVHNNQTVAFNTSDTEDLPVFNATGVLLIQNGSQVSANFDGT VTISVIALSNILHASSSLSEEYRNHTKGLLGVWNDNPEDDFRMPNGSTIPSNTSEETLFH YGMTSETNGIGLLGVRTDPLPSEFTPIFLSQLWNKSGAGEDLISGCNEDAQCKFDILATG NRDIGQSTNSILRTFRHVNGTLNQYPPPIHYSSKIQAYKGREQWPLRSPATLRMSYSASP TSAVAFELFENGSLHVDTNIPRRTYLEILARDVKTNLSSVLQPETVACFCSKEEQCLYNE TSKEGNSSTEVTSCKCDGNSFGRLCEHSKDLCTEPCFPNVDCIPGKGCQACPPNMTGDGR HCVAVEISEFCQNHSCPVNYCYNHGHCDISGPPDCQPTCTCAPAFTGNRCFLAGNNFTPI IYKELPLRTITLSLREDENASNADVNASVANVLENLDMRAFLSNSLVELIRTSPGAPVLG KPIHHWKVVSHFKYRPRGPLIHYLNNQLISAVMEAFLLQARQERRKRSGEARKNVRFFPI SRADVQDGMALNLSMLDEYFTCDGYKGYHLVYSPQDGVTCVSPCSEGYCHNGGQCKHLPD GPQCTCATFSIYTSWGERCEHLSVKLGAFFGILFGALGALLLLAILACVVFHFCGCSMNK FSYPLDSEL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces. These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation. Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation.
Subcellular Location
[Mucin-4 beta chain]: Cell membrane; Multi-pass membrane protein.; [Mucin-4 alpha chain]: Secreted.
Tissue Specificity
Expression is developmentally regulated in the mammary gland, dramatically increases in the lactating gland compared with the virgin mammary gland, while decreasing again during mammary gland involution. Expressed in 13762 ascites cells. Overexpressed in
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1