Recombinant Rat Neurotensin receptor type 1 (Ntsr1)

Code CSB-CF016137RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ntsr1; Ntsr; Neurotensin receptor type 1; NT-R-1; NTR1; High-affinity levocabastine-insensitive neurotensin receptor; NTRH
Species
Rattus norvegicus (Rat)
Expression Region
1-424
Target Protein Sequence
MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTD IYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLA MPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTL MSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQV NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRV QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV SSAINPILYNLVSANFRQVFLSTLACLCPGWRHRRKKRPTFSRKPNSMSSNHAFSTSATR ETLY
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for the tridecapeptide neurotensin (NTS). Signaling is effected via G proteins that activate a phosphatidylinositol-calcium second messenger system. Signaling leads to the activation of downstream MAP kinases and protects cells against apoptosis.
Gene References into Functions
  1. A thermostable variant termed enNTS1 exhibited the best combination of signaling capability and stability upon solubilization with detergents. Several well dispersed (13)CH3-methionine resonances were seen by solution NMR spectroscopy, many of which exhibited chemical shift changes upon the addition of the high affinity agonist peptide, NT8-13. PMID: 29596791
  2. Herein potential interaction between NTS1 receptor, dopaminergic D2 receptor and Na(+), K(+)-ATPase was studied.Results indicated that typical and atypical antipsychotic drugs differentially modulate the interaction between neurotensin and Na(+), K(+)-ATPase. PMID: 27586561
  3. NTS1 agonists as potentially novel drugs for the treatment of schizophrenia. PMID: 26783230
  4. Molecular dynamics simulations of NTS1 in bilayers are in agreement with the ESR data, and point to sites in the receptor where PS could interact with higher affinity PMID: 26926422
  5. Molecular dynamics simulation study on the neurotensin peptide receptor NTSR1 with neurotensin bound, with the aim of understanding the structural basis of thermostabilization and activation PMID: 25807267
  6. This study demonistrated that Ntsr1 and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  7. Maternal separation-induced alternations of DNA methylation in the promoter region of NTSR1 in the amygdala may be associated with vulnerability to the development of anxiety disorders and depression in adulthood PMID: 24831231
  8. the crystal structure at 2.8 A resolution of Rattus norvegicus NTSR1 in an active-like state, bound to NTS(8-13), the carboxy-terminal portion of NTS responsible for agonist-induced activation of the receptor PMID: 23051748
  9. The high-affinity NT receptor may not be involved in ligand binding inhibition to muscarinic receptor by NT. PMID: 20403392
  10. NTR1-like immunoreactive GABAergic neurons are widely distributed in the deep layers of the prefrontal cortex. NTR1 may play a role in PFC interneuron regulation by neurotensin. PMID: 15716398
  11. Data showed a positive correlation between blood ethanol concentration and higher neurotensin receptor 1 density in putamen and ventral midbrain in High and Low Alcohol Sensitive rat lines. PMID: 16953387
  12. Neurotensin 1 receptors play a key role in the regulation of pain signaling in the spinal cord. PMID: 18182046
  13. The potentiating effects of neurotensin on DA and 5-HT release in the PFC are regulated by NTR1 receptors, probably located on dopaminergic and serotonergic nerve terminals or axons. PMID: 18835308

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft.
Protein Families
G-protein coupled receptor 1 family, Neurotensin receptor subfamily, NTSR1 sub-subfamily
Tissue Specificity
Detected in brain and small intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1