Recombinant Rat Occludin (Ocln)

Code CSB-CF016263RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ocln
Uniprot No.
Alternative Names
Ocln; Occludin
Species
Rattus norvegicus (Rat)
Expression Region
1-523
Target Protein Sequence
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLVIVMCIAVFACVASTLAWDRAYGTGIFGGSMNYPYGSGFGSYGGGFGGY GYGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSA ILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYTICSQFYTPGGTGLYVDQYLYHYCVVD PQEAIAIVLGFMIIVAFALIIVFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPDSLYKSPPLVPEVAQEIPLTLS VDDFRQPRYSSNDNLETPSKRTPTKGKAGKAKRTDPDHYETDYTTGGESCDELEEDWLRE YPPITSDQQRQLYKRNFDAGLQEYKSLLAELDEVNKELSRLDRELDDYREESEEYMAAAD EYNRLKQVKGSADYKSKKNYCKQLKSKLSHIKRMVGDYDRRKT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. May be involved in the organization of actin in endothelial cells.
Gene References into Functions
  1. blood occludin levels correlate well with the extent of blood brain barrie damage. PMID: 28079139
  2. Both upregulation of claudin-4 and downregulation of occludin might increase paracellular NaCl transport in the kidney, resulting in impaired pressure natriuresis in SS rats. PMID: 29179201
  3. Up-regulation of miR-144 could promote intestinal hyperpermeability and impair the protective effect of the epithelial barrier by directly targeting OCLN and ZO-1. PMID: 29258088
  4. We provide quantitative evidence that claudin-11 contributes significantly to Sertoli cell tight junction function in vitro. Interestingly, occludin, which is hormonally regulated but not implicated in infertility until late adulthood, is also a significant contributor to barrier function. PMID: 26585695
  5. Mechanical ventilation can activate c-Src by phosphorylation and increase the degradation of occluding. PMID: 25471013
  6. In severe acute pancreatitis, downregulated expression of alphaSNAP in intestinal epithelial cells leads to reduced occludin expression, apoptosis of intestinal epithelial cells, and increased permeability of the intestinal barrier. PMID: 25278303
  7. actin cytoskeletal dynamics is detrimental to METH-induced BBB dysfunction by increasing internalization of occludin. PMID: 24081143
  8. cells transfected with Cx43 siRNA and grown in N medium showed significant downregulation in occludin (78 +/- 8% of control) and ZO-1 (81 +/- 6% of control) expression, and exhibited increased cell monolayer permeability. PMID: 24008412
  9. Results identified a crucial role of occludin in submandibular epithelial cells, and more importantly, demonstrated that occludin was required to mediate TRPV1-modulated paracellular permeability. PMID: 23345400
  10. High temperature inhibited the proliferation of rat Sertoli cells in vitro, and decreased the expression of OCLN. PMID: 23297502
  11. Disruption of pulmonary epithelium induced by hyperoxia is due in part to decreased expression of occludin and zona occludens (ZO)-1 proteins. PMID: 22559818
  12. Reverse-flow perfusions of mesenteric venules showed numerous small gaps in occludin expression on the endothelium. Similar gaps were not seen in vessels perfused in the forward direction. PMID: 23417864
  13. data indicate the possibility that interleukin 6 might be involved in the downregulation of occludin expression and in the modulation of blood-testis barrier permeability that occur in rats undergoing autoimmune orchitis PMID: 23018187
  14. Occludin and Zo-1 were reduced in intestinal mucosa both in mRNA and protein levels in the rat tail-suspension model. PMID: 21336719
  15. Occludin protein loss and claudin-5 redistribution are detected in ischemic microvessels following middle cerebral artery occlusion. PMID: 22378877
  16. Levels of tight junction protein occludin are decreased in blood-brain barrier cells post-translationally following exposure to neurotoxicants. PMID: 20970449
  17. A calcium-activated potassium channel activator increases blood-brain tumor-barrier permeability by down-regulating the expression of occludin. PMID: 21334421
  18. In female rats, increasing age and 17beta-estradiol treatment alters the expression of ERalpha and distinct blood-brain barrier tight-junction protein isoforms (occludin and claudin-5) without altering functional paracellular permeability. PMID: 21192956
  19. the evidence presented herein suggests the implication of occludin and, therefore, of blood-brain barrier in the pathophysiology of extrahepatic cholestasis. PMID: 20170644
  20. There was a significant down-regulation in the expression of occludin abd JAM-1 after exposure to microwave radiation. PMID: 20180397
  21. The presence of occludin in the tight junctions at the time of implantation suggests that the paracellular pathway is impermeable to water and Na(+) at this time, and that the transport of such substances takes place via the transcellular pathway. PMID: 19555995
  22. present in the junctions of the olfactory epithelium, and in the endothelial cells in the blood vessels in the lamina propria of the olfactory mucosa PMID: 11751462
  23. After ligation of the common bile duct, the expression of this protein was elevated in the liver. PMID: 11845325
  24. diabetes-related changes in cerebral zonula occludin-1 expression (zonula occludin-1) PMID: 11958524
  25. Occludin was immunoreactive at distal and proximal complexes of early differentiating ameloblasts and at distal regions of differentiating odontoblasts. However, in more advanced stages, occludin was only evident at the proximal complex of ameloblasts. PMID: 15052661
  26. In vitro blood-brain barrier model studies revealed that the pericyte-derived multimeric angiopoietin-1/Tie-2 pathway induces occludin expression PMID: 15056293
  27. Taken collectively, the results reported herein support the notion that db-cAMP-induced TJ disruption was mediated by an induction of Itch protein expression, which in turn triggered the ubiquitination of occludin resulting in TJ disruption. PMID: 15605377
  28. The effect of matrix metalloproteinase(MMP) inhibitors on endothelial gap formation, occludin loss, and the ability of monocytes to pass the endothelium is reported. PMID: 17065217
  29. These findings indicate the opposite effects of the NMDA and AMPA/kainate receptors on occludin phosphorylation and disruption of the blood-brain barrier. PMID: 17245419
  30. Immunohistochemical expression of occludin and connexin 43 were decreased in the testis after vasal and epididymal ligation. PMID: 17825302
  31. The increase of BK-mediated BTB permeability is associated with the down-regulation of ZO-1, occludin, and claudin-5 and the rearrangement of F-actin;cAMP/PKA might be involved in the modulating process. PMID: 18183615
  32. Chronic ethanol ingestion impairs the airway epithelial barrier function through down-regulation and disruption of membrane localization of occludin and E-cadherin. PMID: 18279593
  33. Increased BBB permeability associated with peripheral inflammatory pain is promoted by the disruption of disulfide-bonded occludin oligomeric assemblies, which renders them incapable of forming an impermeant physical barrier to paracellular transport. PMID: 18647175
  34. The changes in occludin distribution and decreased expression of ZO-1 lead the reorganization of BBB-actin protein, which may be one of the mechanisms of permeability increasing of BBB following hypoxia-ischemia. PMID: 18706176
  35. Cardiopulmonary bypass markedly down-regulates the expression of occludin and ZO-1 proteins in intestinal mucosa of rats. PMID: 18855986
  36. a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues. PMID: 19017651
  37. Transient focal ischemia increased the tyrosine phosphorylation of occludin in the isolated brain capillaries PMID: 19319148
  38. Occludin performs a structural role in inhibiting paracellular diffusion, and a signaling role involving interactions of dimeric and monomeric occludin isoforms within plasma membrane lipid raft domains. PMID: 19457074
  39. Fg binding to endothelial cells (ECs) alters expression of actin-associated endothelial tight junction proteins. PMID: 19507189

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Protein Families
ELL/occludin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1