Recombinant Rat P2Y purinoceptor 2 (P2ry2)

Code CSB-CF017334RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2ry2; P2ru1; P2Y purinoceptor 2; P2Y2; ATP receptor; P2U purinoceptor 1; P2U1; Purinergic receptor
Species
Rattus norvegicus (Rat)
Expression Region
1-374
Target Protein Sequence
MAAGLDSWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYAQGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLSWGHARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSIILVCYVLMARRLLKPAYGTTGLPRAKR KSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSCL DPVLYFLAGQRLVRFARDAKPATEPTPSPQARRKLGLHRPNRTDTVRKDLSISSDDSRRT ESTPAGSETKDIRL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
Gene References into Functions
  1. study suggests that P2Y2R is involved in regulation of bone turnover PMID: 28828576
  2. Activation of renal medullary P2Y2/P2Y4 receptors promotes ET-1-dependent natriuresis in ovariectomized rats. PMID: 28468962
  3. Uridine triphosphate regulates the osteogenic and adipogenic differentiation of bone marrow-derived stromal cells via the P2Y2 receptor. PMID: 26531757
  4. Myocardial expression of the protective P2Y2 receptor subtype is decreased in coronary ischemia-reperfusion injury. PMID: 26070527
  5. in 100-day-old animals, the myocardial inotropic response to the administration of uridine triphosphate was mediated by R2Y2 receptors. R2Y4 receptors took part in the realization of negative inotropic response to uridine triphosphate in all age groups PMID: 24771361
  6. The results of this study suggest that inhibition of P2Y receptors leads to down-regulation of ERK-mediated phosphorylation and increase of the expression of I(A)-related Kv channels in trigeminal ganglion neurons. PMID: 24642246
  7. Thus, P2Y2R activation protects cardiomyocytes from hypoxia in vitro and reduces post-ischemic myocardial damage in vivo. PMID: 23828651
  8. UTP-induced migratory responses required for salivary gland acinar cell self-organization are mediated by the P2Y2R. PMID: 24760984
  9. This is the first report of selective coupling of one type of SK channel to purinergic stimulation of microglia, transactivation of KCa3.1 channels by CRAC/Orai1. PMID: 23620825
  10. A developmental function of P2Y2R in promoting synaptic gene expression. PMID: 23592515
  11. A significant cellular coexpression of P2X3 and P2Y2 in rat DRG neurons. PMID: 23249537
  12. Carotid body type II cells may function as ATP amplifiers during chemotransduction via paracrine activation of P2Y2Rs and Panx-1 channels. PMID: 22733659
  13. Uridine adenosine tetraphosphate induced Nox1-dependent reactive oxygen species generation, which further stimulated MCP-1 formation via MAPK phosphorylation in vascular smooth muscle cells. This process requires the activation of P2Y(2). PMID: 21487675
  14. Amyloid precursor protein (APP) production and secretion are regulated by activation of P2Y2/4 receptors coupled to protein kinase signaling pathways, in a demonstration using astrocytes as a potential source of APP. PMID: 21300137
  15. ATP induces [Ca(2+)](i)-dependent contraction in intestinal subepithelial myofibroblasts, which is mediated through the P2Y(2) receptor PMID: 21296070
  16. Therefore, the spatio-temporal pattern of P2Y(2) gene expression after spinal cord injury suggests a role in the pathophysiology response generated after trauma. PMID: 20619335
  17. Data suggest that increased production of PGE2 by the medullary collecting duct in postobstructive uropathy may be due to increased expression and activity of the P2Y2 receptor. PMID: 20007349
  18. ATP and UTP at low concentrations strongly inhibit bone formation by osteoblasts: a novel role for the P2Y2 receptor in bone remodeling PMID: 12210747
  19. immunostaining of pancreas from streptozotocin-diabetic rats revealed P2Y1 and P2Y2 receptor expression in pancreatic duct cells and P2X1, P2X2, P2Y1 and P2Y2 receptor expression in small blood vessels. PMID: 12850289
  20. Quiescent hepatic stellate cells expressed the P2Y subtypes P2Y(2) and P2Y(4). PMID: 14764443
  21. ATP regulates postsynaptic gene expressions via a common pathway triggered by the activation of P2Y1 and P2Y2 receptors at the nmjs. PMID: 15258260
  22. Because virtually all renal cells release ATP, the observed alterations in P2Y2-R expression in the inner medulla in hydrated and dehydrated states may constitute a novel mechanism of purinergic modulation of collecting duct function. PMID: 15687250
  23. altered expression of P2Y2-R in hydrated and dehydrated states is associated with corresponding changes in P2Y2-R-mediated PGE2 release by the kidney collecting duct PMID: 15840771
  24. study shows that there are different interactions between the subtypes of P2Y purinergic receptors and different Ca(2+)-activated K+ channels PMID: 16075244
  25. P2Y(2)Rs and their associated signaling pathways may be important factors regulating astrogliosis in brain disorders PMID: 16135088
  26. P2Y(2) has a role as a morphogen receptor that potentiates neurotrophin signaling in neuronal development and regeneration PMID: 16365320
  27. The results, which define a novel mechanism for inhibition of apoptosis, implicate parallel, interacting systems--extracellular nucleotides/P2Y2 receptors and neurotrophin/TrkA--to sustain neuronal survival. PMID: 16597733
  28. novel signaling pathway may be involved in the increase in MCP-1 mRNA by activation of P2Y(2) receptors in alveolar and peritoneal macrophage PMID: 17947675
  29. Cultured rat urothelial cells functionally express P2Y(2)/P2Y(4) receptors. PMID: 18216148
  30. muscarinic stimulation-induced Cl(-) reabsorption occurs through basal CFTR activity and that this is regulated by P2Y(2) receptors PMID: 18337312
  31. Stimulatory effect of lipopolyssaccharides as in ATP-dependent upregulation in alveolar cells of P2Y2 receptor. PMID: 18689605
  32. Results suggest that the amount and property of P2Y(2) receptors were changed by cell density, resulting in different patterns observed for internal calcium mobilization . PMID: 19140137
  33. transgenic rat model of P2Y(2)R overexpression may prove useful for linking P2Y(2)R upregulation with chronic inflammatory diseases, neurodegenerative diseases and Sjogren's syndrome PMID: 19155635
  34. P2Y2 and P2Y4 receptors in granulosa cells modulate Cl- permeability by regulating Ca2+-release. PMID: 19191015
  35. P(2y2) and/or P(2y4) receptors may be involved in the enhanced purinergic signaling in lithium induced nephrogenic diabetes insipidus PMID: 19244398

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1