Recombinant Rat Probable G-protein coupled receptor 27(Gpr27)

Code CSB-CF881321RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JJH3
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MANASEPGGGGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLD LCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVGVT RYLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQRPD GAPGALGFLLLLAAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATGQA AANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLLWG PYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCCQS PQATQATLPCDLKGIGL
Source in vitro E.coli expression system
Gene Names Gpr27
Protein Names Recommended name: Probable G-protein coupled receptor 27 Alternative name(s): Super conserved receptor expressed in brain 1
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor. Possible candidate for amine-like G-protein coupled receptor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed as a 3.0 kb transcript, in whole brain, hippocampus, striatum, frontal cortex, thalamus, pons and hypothalamus. A lower molecular weight transcript was detected in all regions examined, except the hypothalamus.
Database Links

KEGG: rno:65275

STRING: 10116.ENSRNOP00000014455

UniGene: Rn.54454

Related Products

Gpr27 Proteins

Gpr27 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.