Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)

Code CSB-CF010154RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q06175
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH
Source in vitro E.coli expression system
Gene Names Hbegf
Protein Names Recommended name: Proheparin-binding EGF-like growth factor Cleaved into the following chain: 1. Heparin-binding EGF-like growth factor Short name= 2. HB-EGF Short name= 3. HBEGF
Expression Region 24-208
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor (By similarity).
Subcellular Location Heparin-binding EGF-like growth factor: Secreted, extracellular space
Tissue Specificity Most abundant in skeletal muscle, lung, spleen brain and heart.
Database Links

KEGG: rno:25433

STRING: 10116.ENSRNOP00000025157

UniGene: Rn.10148

Pathway ErbB signaling pathway
Estrogen signaling pathway

Related Products

Hbegf Proteins

Hbegf Proteins for Rattus norvegicus (Rat)

Hbegf ELISA Kit

Hbegf ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.