Recombinant Rat Proheparin-binding EGF-like growth factor (Hbegf)

Code CSB-CF010154RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hbegf; Dtr; Hegfl; Proheparin-binding EGF-like growth factor
Species
Rattus norvegicus (Rat)
Expression Region
24-208
Target Protein Sequence
ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Gene References into Functions
  1. Heterotrimeric G proteins directly regulate membrane-localized MMP14/MT1-MMP, resulting in HB-EGF release and EGFR transactivation. PMID: 25759388
  2. HB-EGF promotes hepatic stellate cell proliferation via activation of the EGFR and ErbB4 receptors PMID: 24303948
  3. FAK phosphorylation and FAK-mediated signal transduction play essential roles in HB-EGF-mediated intestinal epithelial cell migration and adhesion. PMID: 24703506
  4. Intraluminal administration of HB-EGF reduces the severity of intestinal congestion/repurfusion(C/R) injury in rats. PMID: 23534509
  5. HB-EGF induces cardiomyocyte hypertrophy through an EGFR-ERK5-MEF2A-COX-2 pathway. PMID: 21244855
  6. There were no significant changes in HB-EGF mRNA or protein expression in either the plantaris or the soleus in response to functional overload. PMID: 20696782
  7. HB-EGF contributes to vascular remodeling. PMID: 11882602
  8. HB-EGF expressed in proximity to developing mesencephalic dopaminergic neurons promotes their survival in vitro. HB-EGF may be an important molecule for developing dopaminergic neurons of the ventral midbrain. PMID: 11956950
  9. data indicate HB-EGF gene expression can be regulated by Cdx2 in intestinal epithelial (IEC-6) cells PMID: 12223343
  10. Data suggest that the interaction between HB-EGF and EGFR transactivation is closely related to the proliferation of cardiac fibroblasts and cardiac remodeling after myocardial infarction. PMID: 12237129
  11. HB-EGF mRNA expression and protein production in intestine undergoing ischemia/reperfusion injury PMID: 12746188
  12. Chelerythrine stimulated production of reactive oxygen species, and antioxidants prevented chelerythrine-induced HB-EGF shedding, suggesting that the production of intracellular peroxides is necessary for this event PMID: 15490481
  13. analysis of clearance of HB-EGF in adult and newborn rats PMID: 16364500
  14. 5-HT2A receptor induces ERK phosphorylation and proliferation through TACE enzyme activation and HB-EGF shedding in mesangial cells PMID: 16737974
  15. extracellular superoxide dismutase is related to the epidermal growth factor (EGF) signaling in two ways, competition for HSPG with heparin-binding-EGF and as an ROS scavenger PMID: 16753836
  16. It is suggested that the increased expression of HB-EGF and the inhibition of glial cell swelling may be parts of a protective role of HB-EGF in the ischemic retina. PMID: 16806064
  17. Juxtacrine activation of EGFR by membrane-anchored HB-EGF may play an important role in the regulation of tight junction proteins and transepithelial resistance. PMID: 17855771
  18. Collectively, these data demonstrate that membrane-anchored HB-EGF is targeted to the inner nuclear membrane via a retrograde membrane trafficking pathway. PMID: 18299347
  19. Pro-inflammatory stimuli induce the release of HB-EGF from mesenchyme cells, which stimulates DNA-replication in initiated/premalignant hepatocytes PMID: 18929421
  20. rapid HA accumulation after epidermal wounding occurs through a mechanism requiring cleavage of HB-EGF and activation of EGFR signaling. PMID: 19225541
  21. mechanical stretch promotes fetal type II cell differentiation via ectodomain shedding of HB-EGF and TGF-alpha PMID: 19237431
  22. Hbegf is a potent dilator of terminal mesenteric arterioles. PMID: 19389413

Show More

Hide All

Subcellular Location
[Heparin-binding EGF-like growth factor]: Secreted, extracellular space. Note=Mature HB-EGF is released into the extracellular space and probably binds to a receptor.; [Proheparin-binding EGF-like growth factor]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Most abundant in skeletal muscle, lung, spleen brain and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×