Recombinant Rat Pyroglutamylated RFamide peptide receptor (Qrfpr)

Code CSB-CF019139RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Qrfpr; Gpr103; Pyroglutamylated RF-amide peptide receptor; AQ27; G-protein coupled receptor 103; Orexigenic neuropeptide QRFP receptor; SP9155
Species
Rattus norvegicus (Rat)
Expression Region
1-433
Target Protein Sequence
MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKVAFALAGALIFALAL FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM WHVQRLEIKYDFLYEKEHICCLEEWASPVHQRIYSTFILVILFLLPLVVMLVLYSKIGYE LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVIMMVTVVALFAACWAPFHVVHMMVEYSN FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVKESSSPAR KPGNSGISMMQKRAKLSRPQRPVEETKGDTFSDASIDVKLCEQPREKRQLKRQLAFFSSE LSENSTFGSGHEL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels.
Gene References into Functions
  1. prepro-QRFP mRNA and GPR103a mRNA are expressed in L6 cells, though GPR103b mRNA was not detected. Using complementary assays, co-incubation with QRFP-26, increased insulin's ability to induce glycogen synthesis and 2-deoxyglucose uptake in L6 cells PMID: 25895849
  2. We found an additional receptor with high homology for GPR103 in rat. This receptor increases inositol triphosphate production in transfected cells in presence of QRFP(26) and its mRNA was particularly enriched in the brain.(GPR103 protein, rat) PMID: 16996040
  3. QRFP mRNA was highly expressed in the hypothalamus; QRFP receptor mRNA was highly expressed in the adrenal gland. Data suggests that QRFP and its receptor have a regulatory function in the rat adrenal gland. PMID: 12960173
  4. QRFP and GPR103A/B may regulate diverse neuroendocrine and behavioral functions and implicate this neuropeptide system in metabolic syndrome PMID: 16648250
  5. the expression of GPR103 mRNA was more discrete, notably in the midbrain, the pons, and the medulla oblongata. PMID: 17534937

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the adrenal gland and at moderate levels in the eye and testis. Expressed widely in the brain with high levels in the hypothalamus and moderate levels in the amygdala, basal forebrain, cortex, medulla oblongata, midbrain and thalamus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1