Recombinant Rat Reticulon-1(Rtn1)

Code CSB-CF720677RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Rtn1
Uniprot No. Q64548
Alternative Names Rtn1; Nsp; Reticulon-1; Neuroendocrine-specific protein; S-rex
Species Rattus norvegicus (Rat)
Expression Region 1-777
Target Protein Sequence MAAPPDLQDEPLSPANPGSQLFGGRGEGEEATPKGARPAQQDGEPAWGSGAGAGVVSSRG LCSGPARSPPVAMETASTGVAAVPDALDHSSSPTLKDGEGACYTSLISDICYPPREDSAY FTGILQKENGHITTSESPEELGTPGPSLPEVPGTEPHGLLSSDSGIEMTPAESTEVNKIL ADPLDQMKAEACKYIDITRPQEAKGQEEQSPGLEDKDLDFKDKDSEVSTKPEGVHAPNQP SPVEGKLIKDNLFEESTFAPYIDELSDEQHRMSLVTAPVKITLTEIGPPVMTATHETIPE KQDLCLKPSPDTVPTVTVSEPEDDSPGSVTPPSSGTEPSAAESQGKGSVSEDELIAAIKE AKGLSYETTESPRPVGQAADRPKVKARSGLPTIPSSLDQEASSAESGDSEIELVSEDPMA SEDALPSGYVSFGHVSGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPK REQDSPPMKPGVLDAIREETSSRATEERAPSHQGPVEPDPILSFTPVTLQSRPEPSSGDG APVPEPPKSQQQKPEEEAVSSSQSPAATEIPGPLGSDLVPPLPFFNKQKAIDLLYWRDIK QTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKA YLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALF NGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKIPGAKRHAE
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function May be involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
Gene References into Functions
  1. Collectively, these data support for the first time that RTN1-C may represent a novel candidate for therapies against cerebral ischemia/reperfusion injury. PMID: 28981095
  2. This study identified the intracellular calcium release channel ryanodine receptor 2 as a direct binding partner of RTN1A. PMID: 23454728
  3. neuroendocrine-specific protein-A (NSP-A) as ethanol-responsive gene in the fetal rat brain PMID: 12354640
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Expressed predominantly in central and peripheral nervous system of newborn and adult rats. Low levels have been also detected in heart, adrenal gland and spleen. Expression of isoform RTN1-B is restricted to particular neuronal types.
Database Links

KEGG: rno:116644

UniGene: Rn.55126

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1