Recombinant Rat Sodium/potassium-transporting ATPase subunit beta-2(Atp1b2)

Code CSB-CF002327RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P13638
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKKDEDAENLGHFIMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAARVAFKLRINKA
Source in vitro E.coli expression system
Gene Names Atp1b2
Protein Names Recommended name: Sodium/potassium-transporting ATPase subunit beta-2 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-2
Expression Region 1-290
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known.; FUNCTION
Subcellular Location Cell membrane, Single-pass type II membrane protein
Protein Families X(+)/potassium ATPases subunit beta family
Database Links

STRING: 10116.ENSRNOP00000015076

UniGene: Rn.10624

Pathway cAMP signaling pathway
Cardiac muscle contraction
Th17 cell differentiation
cGMP-PKG signaling pathway

Related Products

Atp1b2 Proteins

Atp1b2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.