Recombinant Rat Somatostatin receptor type 1 (Sstr1)

Code CSB-CF022724RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Sstr1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Species
Rattus norvegicus (Rat)
Expression Region
1-391
Target Protein Sequence
MFPNGTAPSPTSSPSSSPGGCGEGVCSRGPGSGAADGMEEPGRNSSQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCASRISTL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled to phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin insensitive G proteins.
Gene References into Functions
  1. In the jejunums of Cryptosporidium-parvum-infected rats, daily octreotide therapy decreased mRNA levels of SSTR1 on day 14 post-infection, although it increased mRNA levels of SSTR1 on day 50 post-infection. Specific SSTRs may regulate the inflammatory pathway in the rat intestinal inflammation model. PMID: 29522573
  2. All SSTR1-5 proteins were observed at embryonal day 10 and increased with time in major structures, but the localization varied between the different subtypes. Only SSTR1 protein co-localized to a higher extent with the islet hormones studied. PMID: 25926390
  3. up-regulated SSTR1 contributed to neuronal apoptosis after intracerebral hemorrhage, which was accompanied with reduced expression of bcl-2. PMID: 25035058
  4. This study demonistrated that sstr1 and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  5. Most neuropeptide Y expressing receptors in the arcuate nucleus coexpress somatostatin receptor subtype 1. PMID: 15618885
  6. data suggest that higher expression of somatostatin receptor subtype 1 and 2 mRNA induced by the gsp oncogene may be a mechanism by which gsp-positive tumors show a greater response to somatostatin PMID: 16379030
  7. the sequential activation of JAK2, SHP-2, and Src conveys the molecular signaling from SSTR1 to the activation of this phosphatase that is responsible for the final biological effects of SST PMID: 17021051
  8. Sstr1 mediates a dynamic process of endocytosis, recycling, and re-endocytosis of its cognate ligand. PMID: 17170097
  9. All five SSTR are expressed in splanchnic blood vessels. Cirrhosis reduces expression of SSTR1 in portal vein. PMID: 17617126
  10. The combined activation of SSTR1 and -2 shows a partial synergism as far as antiproliferative activity. PMID: 18566118
  11. Postsynaptic localization of sst(1) receptors and synaptic connectivity in the ARC undergo pronounced remodeling in parallel with the GH rhythm. PMID: 19553459

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain, pituitary, islet, jejunum, stomach, heart, spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1