Recombinant Rat Syntaxin-2 (Stx2)

Code CSB-CF022898RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Stx2; Epim; Syntaxin-2; Epimorphin
Species
Rattus norvegicus (Rat)
Expression Region
1-290
Target Protein Sequence
MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
Gene References into Functions
  1. miR-124a aggravates lipopolysaccharide-induced cardiac dysfunction and the miR-124a/STX2 pathway might serve as the potential diagnostic and therapeutic targets for septic cardiac dysfunction. PMID: 28560580
  2. These data provide evidence for EPIM and SOX9 functioning by mutual negative feedback to regulate attributes of the quiescent or activated state of HSCs. PMID: 24971829
  3. Epimorphin has morphogenetic effects on several epithelial tissues, including those of lung. PMID: 25119302
  4. Epimorphin regulates bile duct formation of WB-F344 cells through effects on RhoA and C/EBPbeta, implicating a dual aspect of this morphoregulator in bile duct epithelial morphogenesis. PMID: 21935930
  5. Epimorphin regulates bile duct formation via effects on mitosis orientation PMID: 20305811
  6. expression in intestinal myofibroblasts induces epithelial morphogenesis PMID: 12464668
  7. pIgA-R traffics through postendosomal rab3D-, rab11a-, and syntaxin 2-associated compartments, implicating these proteins in the regulation of transcytosis. PMID: 14578858
  8. In conclusion, epimorphin is a factor that induces differentiation of hepatic stem-like cells through epithelial-mesenchymal cell contact. PMID: 14592430
  9. anti-oxidative function of epimorphin is dramatic and is likely mediated by the activation of EGF receptors and the MEK/extracellular signal-regulated kinase and PI3 kinase/Akt signaling pathways PMID: 16891298
  10. Epimorphin elicits hepatocyte spheroids by inducing proteases in rodent hepatocytes through NF-kappaB. PMID: 17935821

Show More

Hide All

Subcellular Location
Membrane; Single-pass type IV membrane protein.
Protein Families
Syntaxin family
Tissue Specificity
Heart, spleen, liver, and testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1