Recombinant Rutilus rutilus Melanopsin(opn4)

Code CSB-CF764985RIB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6XL69
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rutilus rutilus (Roach)
Sequence MSHHSSWRGHHCAPGDNNCTAGFKESLGSKNYKLLHVPFHGPTHSHHHEPPHPFPTVDVP DHAHYIIGAVILIVGITGVIGNALVIYVFCRSRTLRTAGNMFVVNLAVADFFMSLTQSPV FFAASLHRRWIFGERICELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVGNVSRRK AGAVLAVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFIFVFFI PLGIIVSCYVGIFQAIRAMGKEIRELDCGETQKVYERMQNEWKMAKIALLVILLFVISWS PYSVVALTATAGYSHLLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRAAIARYIPVLRT ILRVKEKELRSSFSSGSVSSRRPTLSSQCSLGVSIGNAARANGRWGKKRLSSASDSDSCW TESEADGSSVSSLTFGRRVSTEISTDTVILSPGSSNSTASGQKSEKAHKVVSVPVPSITF ETDSADESLSDGKALLLGGN
Source in vitro E.coli expression system
Gene Names opn4
Protein Names Recommended name: Melanopsin Alternative name(s): Opsin-4
Expression Region 1-500
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in a subset of retinal horizontal cells as well as in retinal ganglion cells.

Related Products

opn4 Proteins

opn4 Proteins for Rutilus rutilus (Roach)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.