Recombinant Saccharomyces cerevisiae Mitochondrial import receptor subunit TOM70(TOM70)

Code CSB-CF024055SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P07213
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETEGAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM
Source in vitro E.coli expression system
Gene Names TOM70
Protein Names Recommended name: Mitochondrial import receptor subunit TOM70 Alternative name(s): 70 kDa mitochondrial outer membrane protein Translocase of outer membrane 70 kDa subunit
Expression Region 1-617
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the TOM (translocase of outer membrane) receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM20 and TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.
Subcellular Location Mitochondrion outer membrane, Single-pass membrane protein
Protein Families Tom70 family
Database Links

KEGG: sce:YNL121C

STRING: 4932.YNL121C

Related Products

TOM70 Antibodies

TOM70 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

TOM70 Proteins

TOM70 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.