Recombinant Saguinus fuscicollis Melanocyte-stimulating hormone receptor(MC1R)

Code CSB-CF771261SAR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q864H4
Storage Buffer Tris-based buffer,50% glycerol
Species Saguinus fuscicollis (Brown-headed tamarin)
Sequence MPMQGAHRKLLGSLNSTPTATSNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRTSVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAHGIIRLHKRQSPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLCSW
Source in vitro E.coli expression system
Gene Names MC1R
Protein Names Recommended name: Melanocyte-stimulating hormone receptor Short name= MSH-R Alternative name(s): Melanocortin receptor 1 Short name= MC1-R
Expression Region 1-316
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Pathway Melanogenesis

Related Products

MC1R Proteins

MC1R Proteins for Saguinus fuscicollis (Brown-headed tamarin)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.