Recombinant Sheep Melatonin receptor type 1A (MTNR1A)

Code CSB-CF015189SH
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
MTNR1A; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor
Species
Ovis aries (Sheep)
Expression Region
1-366
Target Protein Sequence
MAGRLWGSPGGTPKGNGSSALLNVSQAAPGAGDGVRPRPSWLAATLASILIFTIVVDIVG NLLVVLSVYRNKKLRNAGNVFVVSLAVADLLVAVYPYPLALASIVNNGWSLSSLHCQLSG FLMGLSVIGSVFSITGIAINRYCCICHSLRYGKLYSGTNSLCYVFLIWTLTLVAIVPNLC VGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMLVVVFCYLRIWALVLQVRWKVKPD NKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLVVASDPASMAPRIPEWLFVASYYMA YFNSCLNAIIYGLLNQNFRQEYRKIIVSLCTTKMFFVDSSNHVADRIKRKPSPLIANHNL IKVDSV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
Gene References into Functions
  1. This study demonstrated that the T allele in the SNP rs403212791 in the MNTR1A gene is associated with a lower total days of anestrus and higher progesterone cycling months and estrus cycling months values in the Rasa Aragonesa breed. PMID: 29475126
  2. Data suggest a positive effect of melatonin treatment on the time of first conception in ewe lambs in Sardinia. The G/G genotype of an SNP in Mtnr1a (G612A; melatonin receptor 1A) influences the reproductive response to melatonin treatment; no influence was found for an SNP in KiSS1 (G1035A; kisspeptin-1) or another SNP in Mtnr1a (C606T). PMID: 25375207
  3. The frequency of single nucleotide polymorphisms of MTNR1A in tropical and temperate climate sheep breeds is reported. PMID: 25708518
  4. The data revealed that the MTNR1A gene polymorphisms influenced spring reproductive resumption in the Sarda sheep breed. PMID: 25132211
  5. Haplotype with T, A and T alleles for SNPs 422, 677 (promoter region) and 612 (Exon 2) showed an increase of the percentage of oestrous cyclic ewes. PMID: 22809454
  6. Report the presence of MT(1) and MT(2) receptors in ram spermatozoa. PMID: 22935156
  7. there was a positive correlation between melatonin receptor type 1A (MTNR1A) allele polymorphisms the reproductive response following synchronisation and artificial insemination in the spring PMID: 21211471
  8. MTNR1A transcripts are expressed in the ovine premammillary hypothalamus and their expression follows a diurnal rhythm PMID: 15470001
  9. The current data, on the MT(1) promoter suggests a general model in which melatonin receptor expression in the mammalian pituitary is determined by the balance between stimulatory and inhibitory transcription factors. PMID: 17337323
  10. Polymorphism of the MTNR1A locus is present in the Sarda sheep breed with a high incidence of the C/C genotype. PMID: 19223130
  11. Ewes with at least 1 M allele are able to conceive at younger ages, better able to breed and conceive out-of-season, and have shorter intervals between first and second lambings than ewes expressing only the m allele. PMID: 19359514

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

KEGG: oas:443022

UniGene: Oar.506

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×