Recombinant Todarodes pacificus Rhodopsin(RHO)

Code CSB-CF019681TFR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31356
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)
Sequence GRDLRDNETWWYNPSIVVHPHWREFDQVPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTK TKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFLKKWIFGFAACKVYGFIGGIFGFM SIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWSVLWAIGPIFGWGAYTLEG VLCNCSFDYISRDSTTRSNILCMFILGFFGPILIIFFCYFNIVMSVSNHEKEMAAMAKRL NAKELRKAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQFGPLEWVTPYAAQLPV MFAKASAIHNPMIYSVSHPKFREAISQTFPWVLTCCQFDDKETEDDKDAETEIPAGESSD AAPSADAAQMKEMMAMMQKMQQQQAAYPPQGYAPPPQGYPPQGYPPQGYPPQGYPPQGYP PPPQGAPPQGAPPAAPPQGVDNQAYQA
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 2-448
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity (Probable). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Signaling mediates the activation of phospholipase C (Probable). Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Retina, rhabdomere membrane (at protein level).

Related Products

RHO Proteins

RHO Proteins for Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.