Recombinant Vaccinia virus Plaque-size/host range protein(PS/HR),partial

Code CSB-CF328444VAG1
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P24083
Relevance Regulation of plaque size and host range.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Lister) (VACV)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Research Area others
Source in vitro E.coli expression system
Gene Names PS/HR
Protein Names Protein B5
Expression Region 18-279aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 33.2kDa
Protein Description Extracellular Domain
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulation of plaque size and host range.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Receptors of complement activation (RCA) family

Related Products

PS/HR Proteins

PS/HR Proteins for Vaccinia virus (strain Lister) (VACV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.