Recombinant Vaccinia virus Protein I5(VACWR074)

Code CSB-CF318298VAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P12924
Relevance Envelope protein
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Research Area others
Source in vitro E.coli expression system
Gene Names VACWR074
Protein Names Protein VP13K
Expression Region 2-79aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 24.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Envelope protein.
Subcellular Location Virion membrane, Multi-pass membrane protein
Protein Families Chordopoxvirinae I5 family
Database Links

KEGG: vg:3707607

Related Products

VACWR074 Proteins

VACWR074 Proteins for Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.