Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH)

In Stock
Code CSB-EP340730ARA
Abbreviation Recombinant Autographa californica nuclear polyhedrosis virus VCATH protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP340730ARA could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP340730ARA could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VCATH
Uniprot No.
Research Area
Others
Alternative Names
VCATH; ORF127; Viral cathepsin; V-cath; EC 3.4.22.50; Cysteine proteinase; CP
Species
Autographa californica nuclear polyhedrosis virus (AcMNPV)
Source
E.coli
Expression Region
113-323aa
Target Protein Sequence
PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant AcMNPV VCATH contains amino acids 113-323. The expected molecular weight for the VCATH protein is calculated to be 39.9 kDa. The VCATH protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of VCATH, which enables a simple process of detecting and purifying the VCATH recombinant protein in the following steps.

The Viral Cathepsin (VCATH) of Autographa californica nuclear polyhedrosis virus (AcMNPV) is an enzyme that facilitates the proteolytic processing of viral polyhedron envelope proteins during the late stages of the viral life cycle. VCATH is essential for the maturation of occlusion bodies, which are viral structures containing virions that help in the transmission of the virus between insect hosts. During the late stages of AcMNPV infection, VCATH is involved in the cleavage of polyhedrin, a major constituent of occlusion bodies, to release mature virions. This process ensures the efficient spread of the virus within the insect host. Research on VCATH contributes to the understanding of baculovirus biology, protein processing in viral infections, and the development of baculovirus-based expression systems for the production of recombinant proteins.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death.
Gene References into Functions
  1. V-cath ORFS are expressed as pre-proenzymes. PMID: 19264635
Subcellular Location
Host endoplasmic reticulum.
Protein Families
Peptidase C1 family
Database Links

KEGG: vg:1403960

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*