Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

VCATH

Uniprot No.

P25783

Research Area

Others

Alternative Names

VCATH; ORF127; Viral cathepsin; V-cath; EC 3.4.22.50; Cysteine proteinase; CP

Species

Autographa californica nuclear polyhedrosis virus (AcMNPV)

Source

E.coli

Expression Region

113-323aa

Target Protein Sequence

PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant AcMNPV VCATH contains amino acids 113-323. The expected molecular weight for the VCATH protein is calculated to be 39.9 kDa. The VCATH protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of VCATH, which enables a simple process of detecting and purifying the VCATH recombinant protein in the following steps.

The Viral Cathepsin (VCATH) of Autographa californica nuclear polyhedrosis virus (AcMNPV) is an enzyme that facilitates the proteolytic processing of viral polyhedron envelope proteins during the late stages of the viral life cycle. VCATH is essential for the maturation of occlusion bodies, which are viral structures containing virions that help in the transmission of the virus between insect hosts. During the late stages of AcMNPV infection, VCATH is involved in the cleavage of polyhedrin, a major constituent of occlusion bodies, to release mature virions. This process ensures the efficient spread of the virus within the insect host. Research on VCATH contributes to the understanding of baculovirus biology, protein processing in viral infections, and the development of baculovirus-based expression systems for the production of recombinant proteins.

Target Background

Function

Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death.

Gene References into Functions

V-cath ORFS are expressed as pre-proenzymes. PMID: 19264635

Subcellular Location

Host endoplasmic reticulum.

Protein Families

Peptidase C1 family

Database Links

KEGG: vg:1403960

Code	CSB-EP340730ARA
Abbreviation	Recombinant Autographa californica nuclear polyhedrosis virus VCATH protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP340730ARA could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP340730ARA could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage