Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
VCATH; ORF127; Viral cathepsin; V-cath; EC 3.4.22.50; Cysteine proteinase; CP
Species
Autographa californica nuclear polyhedrosis virus (AcMNPV)
Expression Region
113-323aa
Target Protein Sequence
PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant AcMNPV VCATH contains amino acids 113-323. The expected molecular weight for the VCATH protein is calculated to be 39.9 kDa. The VCATH protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of VCATH, which enables a simple process of detecting and purifying the VCATH recombinant protein in the following steps.
The Viral Cathepsin (VCATH) of Autographa californica nuclear polyhedrosis virus (AcMNPV) is an enzyme that facilitates the proteolytic processing of viral polyhedron envelope proteins during the late stages of the viral life cycle. VCATH is essential for the maturation of occlusion bodies, which are viral structures containing virions that help in the transmission of the virus between insect hosts. During the late stages of AcMNPV infection, VCATH is involved in the cleavage of polyhedrin, a major constituent of occlusion bodies, to release mature virions. This process ensures the efficient spread of the virus within the insect host. Research on VCATH contributes to the understanding of baculovirus biology, protein processing in viral infections, and the development of baculovirus-based expression systems for the production of recombinant proteins.
