Recombinant Mouse C-X-C motif chemokine 16 (Cxcl16), partial

Code CSB-RP093374m
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Cxcl16
Uniprot No.
Research Area
Others
Alternative Names
Cxcl16; SrpsoxC-X-C motif chemokine 16; Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX; Small-inducible cytokine B16; Transmembrane chemokine CXCL16
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
27-198aa
Target Protein Sequence
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
22.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.
Gene References into Functions
  1. the results of the present study suggested that CXCL16 may regulate the TRL4/NFkappaB/CXCL16 signaling pathway, and that miR146a and miR146b may negatively regulate CXCL16 via this pathway in atherosclerosis in vivo. PMID: 30015963
  2. Inflammation accelerates renal tubulointerstitial lesions in mouse model of diabetic nephropathy by increasing the activity of CXCL16 pathway. PMID: 29620052
  3. CXCL16 increases the frequency of the miniature excitatory synaptic currents (mEPSCs) and reduces the PPR of evoked excitatory transmission, indicating that the chemokine also modulates and enhances the release of glutamate. PMID: 27721466
  4. results indicate that CXCL16 plays a key role in the pathogenesis of renal injury and fibrosis in salt-sensitive hypertension through regulation of bone marrow-derived fibroblast accumulation and macrophage and T cell infiltration. PMID: 27353044
  5. Data indicate that chemokine C-X-C ligand 16 (CXCL16) is a critical regulator of liver immune response to acetaminophen (APAP)-induced hepatotoxicity, suggesting a potential strategy for the treatment of drug-induced acute liver failure by targeting CXCL16. PMID: 28459937
  6. CXCL16 plays a crucial role in the pathogenesis of cisplatin-induced acute kidney injury through regulation of apoptosis and inflammation. PMID: 27191747
  7. These findings suggest that the CXCL16 gene product promotes inflammatory factors and cell infiltration factors, and inhibits the expression of antioxidant factors to accelerate the development of DN, and CXCL16 deficiency attenuates DN may be involved in the AKT signaling pathway. PMID: 28478039
  8. Results indicate that CXCL16 plays a pivotal role in the pathogenesis of renal artery stenosis-induced renal injury and fibrosis through regulation of bone marrow-derived fibroblast accumulation and macrophage and T-cell infiltration. PMID: 27496882
  9. Simvastatin exerts a protective effect on renal function and structure in mice with ADR nephropathy which related to the decreasing expression of CXCL16 in glomerular podocytes followed by the decreasing endocytosis of ox-LDL in podocytes and inhibition of NF-kappaB pathway activation. PMID: 26884839
  10. Serum CXCL16 is increased in severe pancreatitis with infected pancreatic necrosis and identifies patients who benefit from surgical necrosectomy PMID: 25661686
  11. injured hepatocytes up-regulated CXCL16 expression, indicating that scavenging functions of CXCL16 might be additionally involved in the pathogenesis of NAFLD. PMID: 25372401
  12. role of IFN-gamma, CXCL16, and ADAM10 in oxLDL-induced lipid accumulation in glomerular podocytes PMID: 24752304
  13. CXCL16 suppresses liver metastasis of colorectal cancer by promoting TNF-alpha-induced apoptosis by tumor-associated macrophages. PMID: 25495942
  14. CXCL16 was constitutively expressed by CX3CR1(+) intestinal dendritic cells (DCs) and coexpressed with IL-23 after Citrobacter rodentium infection. PMID: 25456160
  15. CXCL16 expression inhibits liver metastasis in a murine model of colorectal cancer. PMID: 23242131
  16. our results indicate that CXCL16 plays a pivotal role in the pathogenesis of angiotensin II-induced renal injury and fibrosis through regulation of macrophage and T cell infiltration and bone marrow-derived fibroblast accumulation. PMID: 24060897
  17. Renal dendritic cell-derived CXCL16 might attract protective CXCR6(+) iNKT cells. PMID: 23138484
  18. CXCL16 triggers platelet activation and adhesion via CXCR6 phosphatidylinositide 3-kinase/Akt signaling and paracrine activation, suggesting a decisive role for CXCL16 in linking vascular inflammation and thrombo-occlusive diseases. PMID: 22927331
  19. Induction of experimental autoimmune encephalomyelitis leads to expression of CXCL10 and CXCL16 in immature myeloid cells of draining lymph nodes, in an interferon (IFN)-gamma-dependent manner. PMID: 22287719
  20. regulation of CXCL16, ADAM10 and oxLDL expression may be an early event in the onset of diabetic nephropathy PMID: 19426159
  21. contributes to the pathogenesis of renal fibrosis by recruiting bone marrow-derived fibroblast precursors PMID: 21816936
  22. Data show that CXCL16 becomes much higher in atherosclerosis, and it could be a potential atherogenic biomarker. PMID: 21177121
  23. This study implicates CXCL16 as an additional neutrophil chemoattractant in cerebrospinal fluid in early pneumococcal meningitis. PMID: 20874518
  24. An alternatively spliced CXCL16 isoform expressed by dendritic cells is a secreted chemoattractant for CXCR6+ cells. PMID: 20181724
  25. Overall, our data indicate that up-regulation of CXCL16 is a common response of tumor cells to radiation, and they have important implications for the use of local radiotherapy in combination with immunotherapy. PMID: 20334513
  26. CXCL16 expression is a critical mediator of muscle regeneration PMID: 19893053
  27. SR-PSOX/CXCL16 may be involved in CD8+ T cell recruitment through VLA-4 activation and stimulation of IFN-[gamma] production by CD8+ T cells during inflammatory valvular heart disease. PMID: 14699018
  28. SR-PSOX/CXCL16 plays important roles in EAE by supporting generation of Ag-specific T cells, as well as recruitment of inflammatory mononuclear cells into the CNS. PMID: 15265890
  29. increased IFN-gamma, accompanied by elevation of the scavenger receptor/chemokine CXCL16, was observed in both lesions and spleens after IL18 administration PMID: 15604417
  30. CXCL16, the cell surface ligand for CXCR6, is expressed on sinusoidal endothelial cells, and CXCR6 deficiency resulted in reduced survival in liver natural killer cells. PMID: 15799695
  31. Transmembrane chemokine CXCL16 is expressed in the brain by malignant and inflamed astroglial cells, shed to a soluble form and targets not only activated T cells but also glial cells themselves. PMID: 15934948
  32. CXCL16 plays a unique role in the maintenance of cardiac allograft tolerance mediated by natural killer T cells. PMID: 16081769
  33. CXCL16 is involved in immunological liver injury by regulating T lymphocyte infiltration in liver tissue PMID: 16124049
  34. findings suggest that CXCL16 is an important mediator of lymphocyte-stromal interaction within lymphoid tissues PMID: 16410312
  35. These data suggest that scavenger receptor activity mediated by CXCL16 in vivo is atheroprotective. PMID: 16880330
  36. These results demonstrate a role for CXCL16 in the control of bacterial colonization of target organs and, more specifically, in the regulation of the cell-mediated arm of the primary response to S. enteritidis. PMID: 16982830
  37. CXCL16 is constitutively expressed on the surface of epidermal keratinocytes, released upon cell activation or photodamage and may then target CXCR6-expressing T cells in the dermis PMID: 17363916
  38. SR-PSOX/CXCL16 plays an important role in not only the production of IFN-gamma by NKT cells, but also promotion of Th1-inclined immune responses mediated by NKT cells. PMID: 18056360
  39. Hyperhomocysteinemia up-regulates CXCL16 leading to increased recruitment of CXCR6(+) lymphocytes and scavenging of modified lipids via a potential involvement of a PPAR-gamma-dependent mechanism PMID: 18194461
  40. Data show that the chemokine receptor CXCR6 is highly expressed on glial precursor cells (GPCs) and is induced by its ligand, and that GPCs proliferate and migrate to the sites of CXCL16 production. PMID: 18619850
  41. Ionizing radiation markedly enhanced the secretion by mouse and human breast cancer cells of CXCL16; irradiation increased the migration of CD8(+)CXCR6(+) activated T cells to tumors PMID: 18713980
  42. Report increased production of CXCL16 in experimental heart failure: a possible role in extracellular matrix remodeling. PMID: 19919988

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Intercrine alpha (chemokine CxC) family
Tissue Specificity
Widely expressed. Not detected in purified B- and T-cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*