Cusabio
Product Name:

Recombinant human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein

Product Type:
Recombinant Protein
Code:
CSB-RP046454h   >>   Yeast
CSB-RP046454h   >>   E.coli
CSB-RP046454h   >>   Baculovirus
CSB-RP046454h   >>   Mammalian cell
Size:
1mg
Relevance:
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
Mol. Weight:
49 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis." Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T. Biochem. Int. 20:155-160(1990) [PubMed: 2158323] [Abstract] Cite
Protocol:

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.

AA sequence:
SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLA
LAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCT
HLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG