Code | CSB-EP015270HU |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Recombinant full-length human Myc proto-oncogene protein (MYC) cDNA (439 aa) constructed with a 6xHis-tag at the N-terminus was expressed in E. coli. It got purified up to 90% as determined by SDS-PAGE. Its predicted molecular weight is 52.8 kDa, but the observed is about 60 kDa. Posttranslational modification results in the higher actual molecular weight. CUSABIO has a stock of this recombinant MYC protein, allowing no waiting period of product preparation. This MYC protein may find uses on specific antibody production, iPS generation mechanism mediated by human MYC in vitro, or related signaling transduction.
MYC is an oncoprotein that plays a central role in almost the whole oncogenic process, orchestrating proliferation, apoptosis, differentiation, and metabolism. As a transcription factor, MYC regulates transcription of numerous specific target genes that are involved in distinct cellular functions, such as cell cycle, protein biosynthesis, cell adhesion and cytoskeleton, metabolism, signal transduction, transcription, and translation. Aberrations in MYC protein, including mutations, overexpression, rearrangement, and translocation, have been linked to various hematopoietic tumors, leukemias, and lymphomas.
There are currently no reviews for this product.
We have questions about item CSB-EP015270HU Recombinant human Myc proto-oncogene protein and ask:
1)Do you have any purity information for the current lot? (SDS PAGE)
2)Is the protein coupled with his tag? Cause I didn’t see his in the aa sequence. Could you please sent the complete sequence of the recombinant protein including the tag and any linker present?
3)Is the protein lyophilized in Tris buffer with glycerol?
4)If I need 50 or 100 ug, is it available now?
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA