Recombinant Human Myc proto-oncogene protein(MYC),Escherichia Coli

In Stock
Code CSB-EP015270HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MYC
Uniprot No. P01106
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-439
Target Protein Sequence MPLNVSFTNR NYDLDYDSVQ PYFYCDEEEN FYQQQQQSEL QPPAPSEDIW KKFELLPTPP LSPSRRSGLC SPSYVAVTPF SLRGDNDGGG GSFSTADQLE MVTELLGGDM VNQSFICDPD DETFIKNIII QDCMWSGFSA AAKLVSEKLA SYQAARKDSG SPNPARGHSV CSTSSLYLQD LSAAASECID PSVVFPYPLN DSSSPKSCAS QDSSAFSPSS DSLLSSTESS PQGSPEPLVL HEETPPTTSS DSEEEQEDEE EIDVVSVEKR QAPGKRSESG SPSAGGHSKP PHSPLVLKRC HVSTHQHNYA APPSTRKDYP AAKRVKLDSV RVLRQISNNR KCTSPRSSDT EENVKRRTHN VLERQRRNEL KRSFFALRDQ IPELENNEKA PKVVILKKAT AYILSVQAEE QKLISEEDLL RKRREQLKHK LEQLRNSCA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 52.8 kDa
Protein Length Full length protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

We have questions about item CSB-EP015270HU Recombinant human Myc proto-oncogene protein and ask:
1)Do you have any purity information for the current lot? (SDS PAGE)
2)Is the protein coupled with his tag? Cause I didn’t see his in the aa sequence. Could you please sent the complete sequence of the recombinant protein including the tag and any linker present?
3)Is the protein lyophilized in Tris buffer with glycerol?
4)If I need 50 or 100 ug, is it available now?

A:
Very nice to receive your inquiry. The product details are confirmed as below.
1. You have purchased 500ug of CSB-EP015270HU in P-77819 on 30th January 2018, and we sent you lot 03453. The COA of lot 03453 is attached. The purity of lot 03453 is 85%.
2. The complete sequence is as below. The sequence in front of "+" is the tag sequence, and the sequence behind of "+" is the target protein sequence.

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA


3. The buffer of the current Liquid Form stock is PBS, pH 7.4, 50% glycerol. You could choose Liquid Form or Lyophilized Powder.
If you have special requirement for buffer, please communicate with us and remark the request in your PO.
4. If you would like to order 50ug/100ug, the stock is enough. The details of the current lots are as below. Please confirm which lot you would like.
1) Lot 03453
Delivery Form: Liquid
Storage Buffer: PBS, pH 7.4, 50% glycerol
2) Lot 03475
Delivery Form: Lyophilized Powder
Note: If your order size is 0.5mg*X vials, we could deliver Lyophilized Powder directly. If not, we suggest to deliver Liquid Form.
3) Lot 03628 (Newest Lot)
Delivery Form: Lyophilized Powder
Note: If your order size is 1mg*X vials or 0.02mg* vials, we could deliver Lyophilized Powder directly. If not, we suggest to deliver Liquid Form.
 Customer Reviews

Target Data

Function Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis
Involvement in disease Burkitt lymphoma (BL)
Subcellular Location Nucleus, nucleoplasm, Nucleus, nucleolus
Database Links

HGNC: 7553

OMIM: 113970

KEGG: hsa:4609

STRING: 9606.ENSP00000367207

UniGene: Hs.202453

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.