Recombinant Human Myc proto-oncogene protein(MYC)

In Stock
Code CSB-EP015270HU
Size $1812 How to order?
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Recombinant full-length human Myc proto-oncogene protein (MYC) cDNA (439 aa) constructed with a 6xHis-tag at the N-terminus was expressed in E. coli. It got purified up to 90% as determined by SDS-PAGE. Its predicted molecular weight is 52.8 kDa, but the observed is about 60 kDa. Posttranslational modification results in the higher actual molecular weight. CUSABIO has a stock of this recombinant MYC protein, allowing no waiting period of product preparation. This MYC protein may find uses on specific antibody production, iPS generation mechanism mediated by human MYC in vitro, or related signaling transduction.

MYC is an oncoprotein that plays a central role in almost the whole oncogenic process, orchestrating proliferation, apoptosis, differentiation, and metabolism. As a transcription factor, MYC regulates transcription of numerous specific target genes that are involved in distinct cellular functions, such as cell cycle, protein biosynthesis, cell adhesion and cytoskeleton, metabolism, signal transduction, transcription, and translation. Aberrations in MYC protein, including mutations, overexpression, rearrangement, and translocation, have been linked to various hematopoietic tumors, leukemias, and lymphomas.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MYC
Uniprot No. P01106
Alternative Names AU016757; Avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; Cellular myelocytomatosis oncogene; Class E basic helix-loop-helix protein 39; MGC105490; MRTL; Myc; Myc protein; Myc proto oncogene protein; Myc proto-oncogene protein; myc-related translation/localization regulatory factor; MYC_HUMAN; Myc2; myca; MYCC; Myelocytomatosis oncogene a; Myelocytomatosis oncogene; Niard; Nird; oncogene c-Myc; Oncogene Myc; OTTHUMP00000158589; OTTHUMP00000227763; Proto-oncogene c-Myc; Protooncogene homologous to myelocytomatosis virus; RNCMYC; Transcription factor p64; Transcriptional regulator Myc-A; V-Myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog (avian); zc-myc
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-439
Target Protein Sequence MPLNVSFTNR NYDLDYDSVQ PYFYCDEEEN FYQQQQQSEL QPPAPSEDIW KKFELLPTPP LSPSRRSGLC SPSYVAVTPF SLRGDNDGGG GSFSTADQLE MVTELLGGDM VNQSFICDPD DETFIKNIII QDCMWSGFSA AAKLVSEKLA SYQAARKDSG SPNPARGHSV CSTSSLYLQD LSAAASECID PSVVFPYPLN DSSSPKSCAS QDSSAFSPSS DSLLSSTESS PQGSPEPLVL HEETPPTTSS DSEEEQEDEE EIDVVSVEKR QAPGKRSESG SPSAGGHSKP PHSPLVLKRC HVSTHQHNYA APPSTRKDYP AAKRVKLDSV RVLRQISNNR KCTSPRSSDT EENVKRRTHN VLERQRRNEL KRSFFALRDQ IPELENNEKA PKVVILKKAT AYILSVQAEE QKLISEEDLL RKRREQLKHK LEQLRNSCA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 52.8 kDa
Protein Length Full length protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We have questions about item CSB-EP015270HU Recombinant human Myc proto-oncogene protein and ask:
1)Do you have any purity information for the current lot? (SDS PAGE)
2)Is the protein coupled with his tag? Cause I didn’t see his in the aa sequence. Could you please sent the complete sequence of the recombinant protein including the tag and any linker present?
3)Is the protein lyophilized in Tris buffer with glycerol?
4)If I need 50 or 100 ug, is it available now?

A:
Very nice to receive your inquiry. The product details are confirmed as below.
1. You have purchased 500ug of CSB-EP015270HU in P-77819 on 30th January 2018, and we sent you lot 03453. The COA of lot 03453 is attached. The purity of lot 03453 is 85%.
2. The complete sequence is as below. The sequence in front of "+" is the tag sequence, and the sequence behind of "+" is the target protein sequence.

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA


3. The buffer of the current Liquid Form stock is PBS, pH 7.4, 50% glycerol. You could choose Liquid Form or Lyophilized Powder.
If you have special requirement for buffer, please communicate with us and remark the request in your PO.
4. If you would like to order 50ug/100ug, the stock is enough. The details of the current lots are as below. Please confirm which lot you would like.
1) Lot 03453
Delivery Form: Liquid
Storage Buffer: PBS, pH 7.4, 50% glycerol
2) Lot 03475
Delivery Form: Lyophilized Powder
Note: If your order size is 0.5mg*X vials, we could deliver Lyophilized Powder directly. If not, we suggest to deliver Liquid Form.
3) Lot 03628 (Newest Lot)
Delivery Form: Lyophilized Powder
Note: If your order size is 1mg*X vials or 0.02mg* vials, we could deliver Lyophilized Powder directly. If not, we suggest to deliver Liquid Form.

Target Background

Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release.
Gene References into Functions
  1. the findings of this study demonstrate that hsamiR24 suppresses metastasis in nasopharyngeal carcinoma by regulating the cMyc/EMT axis, suggesting that hsamiR24 may be used as a prognostic factor and as a novel target for the prevention of nasopharyngeal carcinoma metastasis. PMID: 30226609
  2. lncRNA THOR is up-regulated in retinoblastoma, and its over-expression significantly enhances the malignant phenotype transformation of retinoblastoma cells by up-regulating c-myc and TGF2BP1 expression. PMID: 30119193
  3. we demonstrate that neither MYC IHC nor MYC FISH alone is a sufficient screening mechanism for identification of the clinically relevant entities of HGBLwR or DEL PMID: 28868942
  4. Because RPL23 is encoded by a target gene of c-Myc, the RPL23/Miz-1/c-Myc regulatory circuit provides a feedback loop that links efficient RPL23 expression with c-Myc's function to suppress Miz-1-induced Cdk inhibitors and thereby leads to apoptotic resistance in higher-risk myelodysplastic syndrome patients. PMID: 28539603
  5. GATAD2B interacts with C-MYC to enhance KRAS driven tumor growth. PMID: 30013058
  6. low expression of c-Myc protein predicts poor outcomes in patients with HCC with hepatectomy. PMID: 29690860
  7. Combined, these findings suggest that c-Myc could transcriptionally regulate TCRP1 in cell lines and clinical samples and identified the c-Myc-TCRP1 axis as a negative biomarker of prognosis in tongue and lung cancers. PMID: 28623290
  8. Kazakh and Han patients with esophageal squamous cell carcinoma with Glut1 c-myc co-expression had poorer prognosis. PMID: 29629851
  9. MYC activation in papillary clear cell renal cell carcinoma leads to a worse prognosis. PMID: 28593993
  10. could not find any relationship between Bcl-2, c-Myc and EBER-ISH positivity and the low/high IPS groups in classical Hodgkin lymphoma PMID: 29708579
  11. Fluorescence in situ hybridization studies (histologic sections) confirmed translocations of MYC (8q24), BCL2 (18q21) and BCL6 (3q27) in all patients. PMID: 30043475
  12. topical mevastatin accelerates wound closure by promoting epithelialization via multiple mechanisms: modulation of GR ligands and induction of the long noncoding RNA Gas5, leading to c-Myc inhibition. PMID: 29158265
  13. CCND1 , C-MYC , and FGFR1 amplifications were observed in 34.28%, 28.57%, and 17.14% of the 35 samples (invasive ductal breast carcinoma). PMID: 30119151
  14. Data suggest that MYC induction of REV-ERBalpha is both persistent and recurrent across many inducible MYC model systems. PMID: 28332504
  15. HUWE1 overexpression could functionally suppress prostate carcinoma development both in vitro and in vivo, possibly by inverse regulation of c-Myc. PMID: 29966975
  16. Menin functions as an oncogenic regulatory factor that is critical for MYC-mediated gene transcription. PMID: 28474697
  17. High c-myc expression is associated with colorectal cancer. PMID: 30015962
  18. Melatonin disturbs SUMOylation-mediated crosstalk between c-Myc and nestin via MT1 activation and promotes the sensitivity of paclitaxel in brain cancer stem cells. PMID: 29654697
  19. FBP1 modulates the sensitivity of pancreatic cancer cells to BET inhibitors by decreasing the expression of c-Myc. These findings highlight FBP1 could be used as a therapeutic niche for patient-tailored therapies PMID: 30201002
  20. miR135a directly bound to UCA1 and the 3' untranslated region of cmyc, and UCA1 competed with cmyc for miR135a binding. PMID: 30015867
  21. MYC directly regulates DANCR and plays important role in cancer cell proliferation. PMID: 29180471
  22. In this review, we provide support to the hypothesis that the cooperation of c-Myc with transcriptional cofactors mediates c-Myc-induced cellular functions. We produce evidence that recently identified cofactors are involved in c-Myc control of survival mechanisms of cancer cells PMID: 30261904
  23. 4-chlorobenzoyl berbamine (CBBM) inhibits the JAK2/STAT3 pathway, leading to reduced c-Myc transcription. Collectively, these findings suggest that CBBM could be a promising lead compound for treatment of c-Myc-driven diffuse large B cell lymphoma. PMID: 30099568
  24. Results revealed that C-MYC protein is highly expressed in colon cancer tissues, mainly in the cell nucleus and was identified as a direct target for mir-184. C-MYC appeared to participate in cell cycle regulation and malignant transformation to colon cancer. PMID: 28782841
  25. MACC1 and c-Myc are highly expressed in serum and tumor tissues of EC patients. Both are correlated with TNM stage, primary infiltration, and lymph node or distal metastasis. PMID: 29984790
  26. study provides an interesting example using chemical biological approaches for determining distinct biological consequences from inhibiting vs. activating an E3 ubiquitin ligase and suggests a potential broad therapeutic strategy for targeting c-MYC in cancer treatment by pharmacologically modulating cIAP1 E3 ligase activity. PMID: 30181285
  27. The data demonstrated that 10058F4, a cMyc inhibitor, increased the growth inhibition, G0/G1 phase arrest and apoptosis of the NALM6 and CEM cells as induced by dexamethasone (DXM), a type of GC. PMID: 29749488
  28. c-MYC/BCL2 protein co-expression is associated with non-germinal center B-cell in Diffuse Large B-Cell Lymphoma PMID: 29801406
  29. c-Myc was capable of upregulating HP1gamma by directly binding to the E-box element in the first intron of HP1gamma gene, and the upregulated HP1gamma, in turn, repressed the expression of miR-451a by enhancing H3K9 methylation at the promoter region of miR-451a. PMID: 28967902
  30. A subset of pancreatic acinar cell carcinomas shows c-MYC alterations including gene amplification and chromosome 8 polysomy. PMID: 29721608
  31. Expression and Clinical Significance of LC-3 and P62 in Non-small Cell Lung Cancer PMID: 29945702
  32. The findings of the current study demonstrate presence of the IDH1 R132H mutation in primary human glioblastoma cell lines with upregulated HIF-1alpha expression, downregulating c-MYC activity and resulting in a consequential decrease in miR-20a, which is responsible for cell proliferation and resistance to standard temozolomide treatment. PMID: 29625108
  33. a novel signal circuit of Stat3/Oct-4/c-Myc was identified for regulating stemness-mediated Doxorubicin resistance in triple-negative breast cancer PMID: 29750424
  34. MYC amplification and MYC overexpression occurred almost exclusively in secondary cutaneous angiosarcoma in our series. PMID: 29135507
  35. High c-myc expression is associated with the development of prostate cancer. PMID: 29554906
  36. Circular RNA hsa_circRNA_103809 promotes lung cancer progression via facilitating ZNF121-dependent MYC expression by sequestering miR-4302. PMID: 29698681
  37. Authors conclude that quantitative measurements of intratumor heterogeneity by multiplex FISH, detection of MYC amplification and TP53 mutation could augment prognostication in breast cancer patients. PMID: 29181861
  38. PCYT1A was upregulated by MYC, which resulted in the induction of aberrant choline metabolism and the inhibition of B-lymphoma cell necroptosis. PMID: 28686226
  39. Cryptic t(3;8)(q27;q24) and/or MYC-BCL6 linkage associated with MYC expression by immunohistochemistry is frequent in multiple-hit B-cell lymphomas. PMID: 28665415
  40. CD30+ diffuse large B-cell lymphoma has characteristic clinicopathological features mutually exclusive with MYC gene rearrangement and negatively associated with BCL2 protein expression. PMID: 29666157
  41. High MYC amplification is associated with HER2 positive breast cancers in African American women. PMID: 29523126
  42. These data suggest that MYC acts as a master coordinator that inversely modulates the impact of cell cycle and circadian clock on gene expression via its interaction with MIZ1. PMID: 27339797
  43. In our study, the c-myc oncogene was amplified in 11.1% of BPH samples. Bivariate analysis failed to reveal any significant association between oncogene amplification and the clinicopathologic variables examined. PMID: 29234244
  44. Genetic variation at the 8q24.21 renal cancer susceptibility locus affects HIF1A and HIF1B binding to a MYC enhancer. PMID: 27774982
  45. Data indicate that miR-34a enhanced the sensitivity to cisplatin by upregulation of c-Myc and Bim pathway. PMID: 29060932
  46. Luciferase reporter assay showed that c-Myc, an oncogene that regulating cell survival, angiogenesis and metastasis, was a direct target of miR-376a. Over-expression of miR-376a decreased the mRNA and protein levels of c-Myc in A549 cells. PMID: 28741879
  47. The present findings show that expression of c-MYC has prognostic value in squamous cell carcinoma of the tongue, and could be useful in choice of therapy. PMID: 28393404
  48. Multivariable analysis indicated that IPI (P = 0.002), chemotherapy regimens (P = 0.017), and MYC gene rearrangements (P = 0.004) were independent adverse prognostic factors for all diffuse large B cell Lymphoma(DLBCL) patients in this study. Results demonstrated that the poor survival of DLBCL patients with HBV infection was closely involved in chemotherapy regimens, IPI, and MYC gene rearrangements PMID: 29209623
  49. MYC extra copy in diffuse large B-cell lymphoma is an independent poor prognostic factor PMID: 28776574
  50. The c-Myc/miR-200b/PRDX2 loop regulates colorectal cancer (CRC) progression and its disruption enhances tumor metastasis and chemotherapeutic resistance in CRC. PMID: 29258530

Show More

Hide All

Involvement in disease Burkitt lymphoma (BL)
Subcellular Location Nucleus, nucleoplasm. Nucleus, nucleolus.
Database Links

HGNC: 7553

OMIM: 113970

KEGG: hsa:4609

STRING: 9606.ENSP00000367207

UniGene: Hs.202453

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
X