Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 1.501-2.035 ng/mL.
②Anti-CLDN6 antibody(CSB-RA005508MA1HU)immobilized on Protein A Chip can bind Human CLDN6 Full Length Protein-VLP (CSB-MP005508HU(A4)) with an affinity constant of 6.58nM as determined in a MetaSPR assay (WeSPR™ 200).
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
1-220aa
Target Protein Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human Claudin-6 (CLDN6) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human CLDN6 (1-220aa) was expressed with the C-terminal 10xHis tag. The activity was validated by its binding ability in a functional ELISA. This Human CLDN6 recombinant protein was developed through the Virus-Like Particles (VLPs) Platform. It is a four-pass transmembrane protein.
CLDNs are a class of TJ (Tight junctions) transmembrane proteins. From the perspective of spatial structure, most CLDNs contain four transmembrane regions and two extracellular loops, and an intracellular loop with amino and carboxyl termini located in the cytoplasm. Crystal structures of some CLDNs reveal a unique protein fold of the left-handed helical bundle and the four transmembrane helices of the extracellular caudal domain.
CLDN6 can activate cell adhesion signaling and modulate the activity of nuclear receptors. CLDN6 is expressed in a variety of embryonic epithelia, induces the formation and polarity of epithelial cell junctions, and is involved in the differentiation of stem cells into the epithelium. Collectively, CLDN6 is an important part of the CLDN family and plays an important role in maintaining the function of TJs. CLDN6 is specifically expressed in various cancers such as ovarian cancer, testicular cancer, hepatocellular carcinoma and lung adenocarcinoma, differentially expressed on cancer cells, and almost undetectable in adult normal tissues, making it a potential target point.