Home
Active Protein
Other
Recombinant Human Claudin-6 (CLDN6)-VLPs (Active)

Recombinant Human Claudin-6 (CLDN6)-VLPs (Active)

^{In Stock}

Code	CSB-MP005508HU(A4)
Abbreviation	Recombinant Human CLDN6 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$558
	Order now
Image	The presence of VLP-like structures was confirmed by TEM Human CLDN6 Monoclonal Antibody (CSB-RA005508MA1HU) captured on Protein A Chip can bind Human CLDN6 Full Length VLP Protein with an affinity constant of 6.58 nM as detected by MetaSPR Assay (WeSPR^TM 200). Biological Activity Assay The purity of VLPs was greater than 95% as determined by SEC-HPLC Biological Activity Assay CSB-MP005508HU(A4) is detected by Mouse anti-6*His monoclonal antibody. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC₅₀ is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA2HU). The EC₅₀ is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC₅₀ is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA4HU). The EC₅₀ is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control.
②Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA2HU). The EC50 is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control.
③Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control.
④Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA4HU). The EC50 is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

CLDN6

Uniprot No.

P56747

Alternative Names

(Skullin)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-220aa

Target Protein Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Mol. Weight

24.8 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

"The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant)."

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human Claudin-6 (CLDN6) is a high-performance immunogen engineered using a mammalian cell (HEK293) expression system, which is critical for producing this four-pass transmembrane protein in its native, membrane-embedded conformation. The protein corresponds to the full-length sequence (1-220aa) and carries a 10xHis-tag at the C-terminus. This recombinant CLDN6 is presented on the surface of Virus-Like Particles (VLPs), which confer it superior immunogenicity - the particulate structure mimics a natural viral pathogen, efficiently triggering dendritic cell uptake and robust B-cell activation without the need for strong adjuvants. Quality control confirms >95% purity by SEC-HPLC, and functional validation demonstrates specific binding to four anti-CLDN6 antibodies in ELISA, proving the extracellular loops are correctly folded and accessible for high-affinity interactions. This makes it an indispensable tool for investigating the function of CLDN6.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : Drug related studies

Review: CLDN6 is an important member of the CLDN family and plays a crucial role in maintaining the function of tight junctions (TJs). CLDN6 is specifically expressed in various cancers, such as ovarian cancer, testicular cancer, hepatocellular carcinoma, and lung adenocarcinoma, and is differentially expressed in cancer cells. It is almost undetectable in normal adult tissues, making it a potential target. CLDN6 is a four-times transmembrane protein. CUSABIO expresses a full-length recombinant human CLDN6 protein through its unique VLP platform, which has good biological activity. I used the CSB-MP005508HU(A4) product for an ELISA experiment, and the EC50 was measured to be 1.726-3.525 ng/ml. The subsequent experiments progressed smoothly and were of great help to my research. I am considering continuing to purchase in large quantities!

By Anonymous

Target Background

Function

Plays a major role in tight junction-specific obliteration of the intercellular space.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

Gene References into Functions

Antibodies recognizing native CLDN6 as displayed on cell surfaces and mediating complement-dependent cytotoxicity were elicited in vaccinated animals. The data suggest applications of CLDN6 displaying Virus-like particles in cancer immunotherapy. PMID: 29131519
these results suggest that Helicobacter pylori lipopolysaccharide induces TLR2 expression in the gastric adenocarcinoma cells, and that the longer the exposure to lipopolysaccharide, the greater the expression of TLR2 in the cell membrane; consequently the expression of claudin-4, -6, -7 and -9 also increases PMID: 29031421
Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53. PMID: 29116019
CLDN6 enhances the chemoresistance to ADM via activating the AF-6/ERK signaling pathway and up-regulating cancer stem cell characters in MDAMB231 cells. PMID: 29159771
we demonstrated that the downregulation of CLDN6 is regulated through promoter methylation by DNMT1, which depends on the SMAD2 pathway, and that CLDN6 is a key regulator in the SMAD2/DNMT1/CLDN6 pathway to inhibit EMT, migration and invasion of breast cancer cells PMID: 28867761
In conclusion, this information from bioinformatics analysis will help future attempts to better understand CLDN6 regulation and functions. PMID: 28656265
high expression of CLDN 6 was observed in approx. 65% of the myxofibrosarcomas, whereas the benign soft tissue tumors did not show a high expression of CLDN 6. The expression of CLDN 6 in the myxofibrosarcomas was significantly higher than those of other tumor specimens. Among the myxofibrosarcomas, the high expression of CLDN 6 was correlated with high FNCLCC grades and high AJCC stages. PMID: 28476380
Results show that DNA methylation down-regulates CLDN6 expression through MeCP2 binding to the CLDN6 promoter, deacetylating H3 and H4, and altering chromatin structure, consequently promoting migratory and invasive phenotype in breast cancer cells. PMID: 27461117
Cldn6 was decreased in alveolar type II-like epithelial cells (A549) and primary small airway epithelial cells when exposed to cigarette smoke ext PMID: 27982694
suggest that claudin-6 induces MMP-2 activation through claudin-1 membrane expression PMID: 27914788
Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry. PMID: 26561856
The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues. PMID: 26191261
High levels of CLDN6 are associated with non-small-cell lung cancer. PMID: 24710653
The expression of claudin-6 was down regulated in gastric cancer tissue. PMID: 23919729
Only some hepatitis C virus strains efficiently use CLDN6 for infection. PMID: 23775920
This work provides a proof of concept for the use of Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture. PMID: 23778593
Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9. PMID: 23864633
ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer. PMID: 22925655
Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomas PMID: 22455563
CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors. PMID: 21989342
17beta-E2 might regulate the expression of claudin-6 and inhibit the proliferation and migration of MCF-7 cells. PMID: 20388399
Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line. PMID: 20874001
CLDN6 may be a useful positive marker to help further identify atypical teratoid/rhabdoid tumors for diagnostic and treatment purposes PMID: 19220299
Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis PMID: 19960275
The up-regulation of claudin-6 expression in MCF-7 breast cancer cells suppresses their malignant phenotypes with a correlation with the restoration of tight junction integrity. PMID: 20367941
claudin-6, downregulates the malignant phenotype of breast carcinoma. PMID: 20215972
Claudin 6 was not found in epithelioid glioblastomas or rhabdoid glioblastomas. PMID: 20118769
CLDN6 and CLDN9, but not CLDN1, are expressed in peripheral blood mononuclear cells, an additional site of HCV replication. PMID: 17804490
claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes. PMID: 18234789
CLDN6, clustered with CLDN9 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID: 12736707