Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC50 is 29.56-50.75 ng/mL.
Alternative Names
(Clostridium perfringens enterotoxin receptor)(CPE-R)(CPE-receptor)(Williams-Beuren syndrome chromosomal region 8 protein)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
1-209aa
Target Protein Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human Claudin-4 (CLDN4) recombinant protein was produced in mammalian cell, where the gene sequence encoding human CLDN4 (1-209aa) was expressed with the C-terminal 10xHis tag. The activity was validated.
In addition, this recombinant human CLDN4 protein was developed through the Virus-Like Particles (VLPs) Platform. It is a four-pass transmembrane protein.
Both CLDN4 and CLDN8 are considered to be cation barriers and anion channels. We found that catheter-specific knockout of CLDN4 caused hypotension, hypochloremia, metabolic alkalosis, and renal failure symptoms of Na+ and Cl−, and overexpression of CLDN4 resulted in cation-selective MDCK II and anion-selective LLC-PK1 TER was increased in cells, and a decrease in Na+ permeability was observed in MDCK II cells.
In diabetes, CLDN4 is overexpressed in the distal nephron of type 1 diabetic rats mediated by divergent aldosterone levels, and the expression of WNK4 and its colocalization with CLDN4 and CLDN8 are also increased. This may lead to increased activation of CLDN4 and CLDN8 by WNK4 under diabetic conditions.