Name: Recombinant Human Claudin-4(CLDN4)-VLPs (Active)
Brand: CUSABIO
SKU: CSB-MP005506HU

Product Details

Description	This Human Claudin-4 (CLDN4) recombinant protein was produced in mammalian cell, where the gene sequence encoding human CLDN4 (1-209aa) was expressed with the C-terminal 10xHis tag. The activity was validated. In addition, this recombinant human CLDN4 protein was developed through the Virus-Like Particles (VLPs) Platform. It is a four-pass transmembrane protein. Both CLDN4 and CLDN8 are considered to be cation barriers and anion channels. We found that catheter-specific knockout of CLDN4 caused hypotension, hypochloremia, metabolic alkalosis, and renal failure symptoms of Na⁺ and Cl⁻, and overexpression of CLDN4 resulted in cation-selective MDCK II and anion-selective LLC-PK1 TER was increased in cells, and a decrease in Na⁺ permeability was observed in MDCK II cells. In diabetes, CLDN4 is overexpressed in the distal nephron of type 1 diabetic rats mediated by divergent aldosterone levels, and the expression of WNK4 and its colocalization with CLDN4 and CLDN8 are also increased. This may lead to increased activation of CLDN4 and CLDN8 by WNK4 under diabetic conditions.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC₅₀ is 29.56-50.75 ng/mL.
Target Names	CLDN4
Uniprot No.	O14493
Alternative Names	(Clostridium perfringens enterotoxin receptor)(CPE-R)(CPE-receptor)(Williams-Beuren syndrome chromosomal region 8 protein)
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	1-209aa
Target Protein Sequence	MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Mol. Weight	23.4 kDa
Protein Length	Full Length
Tag Info	C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions	Claudin-4 expression can be absent or very focal in a subset of high-grade endometrial carcinomas PMID: 29671892 these results suggest that Helicobacter pylori lipopolysaccharide induces TLR2 expression in the gastric adenocarcinoma cells, and that the longer the exposure to lipopolysaccharide, the greater the expression of TLR2 in the cell membrane; consequently the expression of claudin-4, -6, -7 and -9 also increases PMID: 29031421 HIF-1alpha expression was upregulated in the vasculogenic mimicry-positive CRC cell line HCT-116 and thereby affected the expression of the EMT-related markers Claudin-4, E-cadherin (E-cd) and Vimentin(VIM). PMID: 27869227 expression of claudin-4 is highly specific for true epithelial differentiation and may be useful to distinguish SWI/SNF complex-deficient undifferentiated carcinomas from sarcomas with epithelioid morphology. The lack of claudin-4 expression in ovarian small cell carcinomas of hypercalcemic type suggests that these tumors may be better regarded as sarcomas rather than carcinomas. PMID: 28084340 Data indiate a regulatory network in gastric cancer whereby claudin-4 expression is reduced by specific miRNAs, which are in turn bound by specific lncRNAs acting as competing endogenous RNAs (ceRNAs), resulting in increased claudin-4 expression. PMID: 28819095 This is the first study to show how TGF-beta regulates the expression of Claudin-4 through c-Jun signaling and how this pathway contributes to the migratory and tumorigenic phenotype of lung tumor cells. PMID: 27424491 Claudin-4 functionally contributes to both ovarian tumor cell apoptosis resistance and migration and targeting extracellular loop interactions of claudin-4 may have therapeutic implications for reducing ovarian tumor burden. PMID: 27724921 Fluorescence-based flow cytometry and xenon magnetic resonance imaging (MRI) indicate binding of the biosensor specifically to claudin 4 (Cldn4)-expressing cells. PMID: 28636798 Studies indicate that Grainyhead-like transcription factor 2 (GRHL2) controls the expression of E-cadherin (CDH1) required for adherens junctions and possibly regulates the expression of claudin-4 (CLDN4) in tight junctions. PMID: 28636799 Studies indicate claudin 1 (CLDN-1) as a target for improving epidermal drug absorption and preventing HCV infection and of claudin 4 (CLDN-4) as a target for anticancer therapeutics. PMID: 28415141 Mislocalization claudin-3 to nucleus in colon cancer and mislocalization claudin-4 to nucleus in adenomas of the colon were detected for the first time. The potential reasons for the paradoxical expression are discussed and a review of the literature, related all the alleged mechanisms of this mislocalization is provided. PMID: 28295005 Reg I may play a role in the maintenance of mucosal barrier function by inducing tight junction proteins such as claudins 3 and 4. PMID: 27055226 claudin-4 may represent different mechanisms of lymphatic vessel invasion with both biomarkers is related to poor prognosis PMID: 26464161 These results suggested that increase of Cldn4-expression may be involved in early molecular events during carcinogenesis of adenocarcinoma, whereas increase of Cldn7-expression may be associated with tumor invasion or progression. PMID: 26872891 that claudins-4 and -7 might be valuable markers for distinguishing hepatocellular carcinoma and cholangiocarcinoma and that cholangiolocellular carcinoma might arise from hepatic ductal cells PMID: 27444172 that claudin-4 can be helpful at least in making a reliable differential diagnosis of spiradenoma when overlapping morphologic features do not allow to further subclassification in the overwhelming variety of the adnexal tumors. PMID: 26616722 Results showed overexpression of CLDN4 in endometrial cancer cells. Its intracellular presence coupled with the biphasic effects of E2 on its expression in the cytoskeleton suggest that it may be involved in cell signaling to and from tight junctions. PMID: 26043767 claudin 1 and claudin 4 are differentially involved in atopic dermatitis pathogenesis PMID: 26319240 Results suggested that claudin-4, which was regulated by methylation status, plays an important role in breast cancer growth and malignancy via the control of cell proliferation, migration and apoptosis. PMID: 26058359 Overexpression of claudin-4 induced formation of vascular channels in breast cancer. PMID: 25871476 This meta-analysis shows that over-expression of claudin-4 is associated with progress of gastric cancer and poor prognosis of gastric cancer patients. PMID: 26109060 Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity. PMID: 25697377 Data show that claudin-4 and claudin-7 were observed in hepatocytes of severely damaged mouse and human livers. PMID: 24737165 increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer PMID: 25755790 Studies suggest that claudin-3 and claudin-4 might be targets for the treatment of chemotherapy-resistant ovarian cancer and other tumors overexpressing claudin-3 and -4 using Clostridium perfringens enterotoxin (CPE)-based theranostic agents. PMID: 23685873 Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through beta-catenin PMID: 25344320 Our results indicate that CLDN4 expression is correlated with poor prognosis, and CLDN1 expression may be an indicator of recurrence of oral squamous cell carcinoma. PMID: 25964581 Claudin-4 is frequently expressed in primary breast cancers but especially in their metastases and is thereby an attractive membrane bound molecular imaging and drug target. PMID: 25417118 Claudins 2 and 4 have reciprocal effects on epithelial barrier function, exhibit differential FRAP dynamics, and compete for residency within the tight junction. PMID: 25031428 Increased claudin 4 expression was related to advanced stage and decreased survival in nasopharyngeal carcinoma. PMID: 25778318 Claudin 1, 4, and 7 are important building blocks of paracellular adhesion molecules; their decreased expression in colorectal cancer seems to have critical effects on cell proliferation, motility, invasion, and immune response against the tumor. PMID: 25038829 upregulation of claudin-4 expression regulated by DeltaNp63 might be associated with complementary or repair responses of damaged keratinocytes with atopic dermatitis PMID: 25449274 The present study demonstrates that high expression of claudins 1, 4, 5 and down-regulation of claudin-7 are positive prognostic markers and are associated with good outcome and increased survival rates. PMID: 24815833 Low expression of claudin-4 is associated with recurrence in esophageal squamous cell carcinoma. PMID: 24737010 The degradation of claudin-3 and claudin-4 induced by acidic stress could be attenuated by specific TRPV1 blockers. PMID: 24073800 twist and zeb1 are involved in placental maturation, whereas claudin 4 appears to be connected with placental diseases such as diabetes, toxaemia or molar disease. PMID: 24304426 Claudin-4 immunohistochemistry effectively distinguishes adenocarcinoma from malignant mesothelioma with high sensitivity and specificity in the evaluation of malignant effusions. PMID: 24421209 Claudin-4 was very useful marker for distinguishing mesothelioma and adenocarcinoma PMID: 23775021 claudin-4 and PAX8 have a higher sensitivity and specificity for discriminating between pleural epithelioid mesotheliomas and renal cell carcinomas compared with other positive carcinoma markers PMID: 23503645 High claudin-4 expression is associated with gastric carcinoma. PMID: 23822740 PAX8 and claudin-4 have a higher sensitivity and specificity for assisting in discriminating between peritoneal epithelioid mesotheliomas and serous carcinomas when compared with all of the other positive carcinoma markers PMID: 23196794 Exceedingly high levels of CLDN4 might negatively influence fertility rates. PMID: 23668053 Knockdown of claudin-4 inhibited cell motility and the mimic peptide had no effect on motility in the claudin-4 knockdown cells. PMID: 23521713 Claudin-4 is a highly specific and sensitive immunohistochemical marker for assisting in distinguishing epithelioid mesotheliomas from metastatic carcinomas to the serosal membranes. PMID: 23596113 Altered claudin-4 expression in progesterone-treated endometrial adenocarcinoma cell line Ishikawa. PMID: 23095775 Claudin-3(CLDN3) and claudin-4 (CLDN4) affect sensitivity of the ovarian cancer cells to the cytotoxic effect of cisplatin by regulating expression of the Cu transporter CTR1. PMID: 23053666 Modeling the "airway reopening" process, examined consequent increases in pulmonary epithelial plasma membrane rupture, paracellular permeability, and disruption of the tight junction proteins zonula occludens-1 and claudin-4. PMID: 22898551 High CLDN4 expression is associated with tumor growth and metastases. PMID: 23097631 Progesterone could inhibit the growth of Ishikawa cells by decreasing the expression of claudin-4. PMID: 22883527 these results indicate that Twist1 induces the repression of claudin-4 expression during the epithelial-mesenchymal transition in esophageal carcinoma. PMID: 22668877 Show More Hide All
Involvement in disease	CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
Subcellular Location	Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families	Claudin family
Database Links	HGNC: 2046 OMIM: 602909 KEGG: hsa:1364 STRING: 9606.ENSP00000342445 UniGene: Hs.647036

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP005506HU
Size
Image	CSB-MP005506HU is detected by Mouse anti-6*His monoclonal antibody. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/ml can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC₅₀ is 29.56-50.75 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Claudin-4(CLDN4)-VLPs (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage