Cusabio
Product Name:

Recombinant human Tumor necrosis factor receptor superfamily member 1A protein for

Product Type:
Recombinant Protein
Code:
CSB-RP072244h   >>   Yeast
CSB-RP072244h   >>   E.coli
CSB-RP072244h   >>   Baculovirus
CSB-RP072244h   >>   Mammalian cell
Size:
1mg
Relevance:
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Mol. Weight:
46 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Molecular cloning and expression of the human 55 kd tumor necrosis factor receptor." Loetscher H., Pan Y.-C.E., Lahm H.-W., Gentz R., Brockhaus M., Tabuchi H., Lesslauer W. Cell 61:351-359(1990) [PubMed: 2158862] [Abstract] Cited for: NUCLEOTIDE S
AA sequence:
VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCL
SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHA
GFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT