Cusabio
Product Name:

Recombinant human Ubiquitin-like protein ISG15 protein

Product Type:
Recombinant Protein
Code:
CSB-RP097444h   >>   Yeast
CSB-RP097444h   >>   E.coli
CSB-RP097444h   >>   Baculovirus
CSB-RP097444h   >>   Mammalian cell
Size:
1mg
Relevance:
Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21 In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy By similarity. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21
Mol. Weight:
44 KD
Product Info:
GST tagged
Purity:
90%
Image:
Storage Buffer:
Tris-based buffer,50% glycerol
Storage:
Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Referrences:
[1] "Molecular characterization of the interferon-induced 15-kDa protein. Molecular cloning and nucleotide and amino acid sequence." Blomstrom D.C., Fahey D., Kutny R., Korant B.D., Knight E. Jr. J. Biol. Chem. 261:8811-8816(1986) [PubMed: 3087979] [Abs
AA sequence:
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTV
LLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG
LKPLSTVFMNLRLRGG