Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-AP003541HU |
Size | Inquiry How to order? |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL. |
Target Names | CXCL2 |
Uniprot No. | P19875 |
Research Area | Immunology |
Alternative Names | C-X-C motif chemokine 2; Chemokine (C X C motif) ligand 2; Chemokine; CXC motif; ligand 2; CINC 2a; CINC2a; CINC3; CXC chemokine; CXCL 2; Cxcl2; CXCL2_HUMAN; Cytokine-induced neutrophil chemoattractant 3; GRO 2; GRO b; GRO protein; beta; Gro-beta; GRO-beta(5-73); GRO-beta-T; GRO2; GRO2 oncogene; GROb; GRObeta; Growth regulated protein beta; Growth-regulated protein beta; GROX; Hematopoietic synergistic factor; HSF; Macrophage inflammatory protein 2 alpha; Macrophage inflammatory protein 2; Macrophage inflammatory protein 2-alpha; Melanoma growth stimulatory activity beta; MGSA b; MGSA beta; MIP 2; MIP 2a; MIP2 alpha; MIP2; MIP2-alpha; MIP2A; MIP2alpha; SB-251353; SCYB 2; Scyb; SCYB2; Small inducible cytokine subfamily B; member 2 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 39-107aa |
Complete Sequence | TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Mol. Weight | 7.67 kDa |
Protein Length | Partial |
Tag Info |
Tag-Free |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 400 mM NaCl, pH 8.5 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database Links |
HGNC: 4603 OMIM: 139110 KEGG: hsa:2920 STRING: 9606.ENSP00000427279 UniGene: Hs.75765 |