Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL.
Alternative Names
C-X-C motif chemokine 2; Chemokine (C X C motif) ligand 2; Chemokine; CXC motif; ligand 2; CINC 2a; CINC2a; CINC3; CXC chemokine; CXCL 2; Cxcl2; CXCL2_HUMAN; Cytokine-induced neutrophil chemoattractant 3; GRO 2; GRO b; GRO protein; beta; Gro-beta; GRO-beta(5-73); GRO-beta-T; GRO2; GRO2 oncogene; GROb; GRObeta; Growth regulated protein beta; Growth-regulated protein beta; GROX; Hematopoietic synergistic factor; HSF; Macrophage inflammatory protein 2 alpha; Macrophage inflammatory protein 2; Macrophage inflammatory protein 2-alpha; Melanoma growth stimulatory activity beta; MGSA b; MGSA beta; MIP 2; MIP 2a; MIP2 alpha; MIP2; MIP2-alpha; MIP2A; MIP2alpha; SB-251353; SCYB 2; Scyb; SCYB2; Small inducible cytokine subfamily B; member 2
Species
Homo sapiens (Human)
Expression Region
39-107aa
Complete Sequence
TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 150mM NaCl, pH 8.0.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products
out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Datasheet & COA
Please contact us to get it.