Recombinant Human C-X-C motif chemokine 2 (CXCL2), partial (Active)

Unavailable
Code CSB-AP003541HU
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL.
Target Names
CXCL2
Uniprot No.
Research Area
Immunology
Alternative Names
C-X-C motif chemokine 2; Chemokine (C X C motif) ligand 2; Chemokine; CXC motif; ligand 2; CINC 2a; CINC2a; CINC3; CXC chemokine; CXCL 2; Cxcl2; CXCL2_HUMAN; Cytokine-induced neutrophil chemoattractant 3; GRO 2; GRO b; GRO protein; beta; Gro-beta; GRO-beta(5-73); GRO-beta-T; GRO2; GRO2 oncogene; GROb; GRObeta; Growth regulated protein beta; Growth-regulated protein beta; GROX; Hematopoietic synergistic factor; HSF; Macrophage inflammatory protein 2 alpha; Macrophage inflammatory protein 2; Macrophage inflammatory protein 2-alpha; Melanoma growth stimulatory activity beta; MGSA b; MGSA beta; MIP 2; MIP 2a; MIP2 alpha; MIP2; MIP2-alpha; MIP2A; MIP2alpha; SB-251353; SCYB 2; Scyb; SCYB2; Small inducible cytokine subfamily B; member 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
39-107aa
Complete Sequence
TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Mol. Weight
7.67 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 150mM NaCl, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
Gene References into Functions
  1. The studies revealed that, although overall structural and oligomerization features of CXCL3 and CXCL2 are similar, prominent differences were observed in their surface characteristics, thus implicating a functional divergence. PMID: 28928065
  2. Taken together, the data of the present study demonstrated that TcpC can induce MIP2 production, which may contribute to the characteristic histological change associated with pyelonephritis. PMID: 28765918
  3. Functional effects data suggested that recombinant human CXCL2 significantly enhanced the migration, invasion ability of SMMC7721 hepatocellular carcinoma cells, and weakened adhesion ability. PMID: 27117207
  4. Reduced rate of sickle-related complications in Brazilian patients carrying HbF-promoting alleles at the BCL11A and HMIP-2 loci PMID: 26888013
  5. Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403
  6. Chronic inflammation contributes to the change of CXCL12 DNA methylation in buccal cells and that DNA methylation profile of CXCL12 promoter plays important role in development and progression of periodontal disease. PMID: 27580404
  7. high GRO-beta expression correlates with poor prognosis and contributes to ovarian cancer tumorigenesis and metastasis. PMID: 26063953
  8. In this review, a genetic variant in CXCL12 is described that is associated with type 2 diabetes mellitus and its complications. PMID: 25085744
  9. We have demonstrated that GRObeta, as an oncogene product, contributed to tumorigenesis and metastasis of HCC PMID: 25801245
  10. Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075
  11. autophagy is required for Hepatitis B virus-induced NF-kappaB activation and release of IL-6, IL-8, and CXCL2 in Hepatocytes PMID: 25708728
  12. The results link CXCL1 and CXCL2 chemokines with bone marrow adiposity and implicate CXCR2 signaling in promoting effects of marrow fat on progression of skeletal tumors in bone. PMID: 25802102
  13. CXCL2 has antimicrobial activity against E. coli and S. aureus. PMID: 12949249
  14. Simultaneous targeting of hCAP-G2 and MIP-2A is a promising strategy for the development of antitumor drugs as a treatment for intractable tumours. PMID: 24098805
  15. our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration PMID: 23904157
  16. CXCL12 and CXCR4 are related to formation of gastric tumors and lymph node metastasis PMID: 21630055
  17. Ubiquinol decreases monocytic expression and DNA methylation of the pro-inflammatory CXCL2 gene in humans. PMID: 23021568
  18. CXCL2, a WAT-produced chemokine being up-regulated in obesity, stimulates neutrophil adhesion to vis WAT endothelial cells. Activated neutrophils in obesity may influence vis WAT-ECs functions and contribute to WAT inflammation. PMID: 23372021
  19. This is the first report showing the role of CXCL2 in cancer-associated bone destruction. PMID: 22771802
  20. Anti-human ANXA1 antibodies and, to a lesser extent, anti-human ANXA4 antibodies increased MIP-2 or IL-8 production. PMID: 22056994
  21. Data suggest that GRObeta may function as an oncogene product and contribute to tumorigenesis and metastasis of esophageal squamous cell carcinoma. PMID: 21677836
  22. It can be hypothesized that for some targets, such as CXCL1 and CXCL2, additional signaling may be necessary to fully activate the 3'untranslated region-dependent human antigen R (HuR) function in airway epithelium PMID: 21220697
  23. A significantly increased expression of GRO-2, GRO-3, and IL-8 in colon carcinoma as compared to normal tissue, is reported. PMID: 20162422
  24. G-CSF stimulates the expression of the MIP-2 receptor via STAT3-dependent transcriptional activation of Il8rb PMID: 20185584
  25. modulation of the GRO beta concentration in the endometrium by inflammatory mediators may contribute to the normal and pathological processes of human reproduction by regulating the trafficking of neutrophils into the endometrium PMID: 12892904
  26. Neutrophil elastase, MIP-2, and TLR-4 have roles in progression of human sepsis and murine peritonitis PMID: 15614130
  27. CXCL2 tandem repeat promoter polymorphism is associated with susceptibiltiy to severe sepsis in the Spanish population. PMID: 16421598
  28. CXC chemokine CXCL10 and CC chemokine CCL2 serum levels increase with normal aging PMID: 16697212
  29. Inhibition of ERK phosphorylation decreased expression of Grob. PMID: 17466952
  30. data suggest that a tandem repeat polymorphism (AC)n at position -665 in the CXCL2 gene may be an independent predictor of mortality for severe sepsis PMID: 17944017
  31. Decrease of CXCL1 and -2 mediated by Curcumin is involved in the inhibition of metastasis in breast cancer cells. PMID: 17999991
  32. Peripheral neutrophilia and increased serum chemokines (IL-8 and MIP-2) may indicate hepatic injuries in glycogen storage disease type Ia. PMID: 18191274
  33. Resident tissue macrophages are the major source of MIP-2 and KC chemokines; these chemokines are newly synthesized products of signaling through Toll-like receptors. PMID: 18322244
  34. In colon epithelial cells, induction of MIP-2 alpha expression by tumor necrosis factor-alpha was accompanied by a concomitant reduction in miR-192 expression and miR-192 was observed to regulate the expression of MIP-2 alpha. PMID: 18835392
  35. Report gonadotropin-releasing hormone-regulated CXCL2 expression in human placentation. PMID: 19369450

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 4603

OMIM: 139110

KEGG: hsa:2920

STRING: 9606.ENSP00000427279

UniGene: Hs.75765

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*