Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CXCL2

Uniprot No.

P19875

Research Area

Immunology

Alternative Names

Growth-regulated protein beta;Gro-beta;Macrophage inflammatory protein 2-alpha;MIP2-alpha

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

35-107aa

Target Protein Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression of the recombinant Human CXCL2 protein entails introducing a DNA expression vector containing the gene for the desired protein (35-107aa) into e.coli cells through transformation. Subsequently, the cells are cultured to facilitate the expression of the intended protein. The protein features a N-terminal 10xHis-GST tag and C-terminal Myc tag fusion. The resulting recombinant Human CXCL2 protein is then gathered and purified from the cell lysate using affinity purification. Its purity, determined by SDS-PAGE, exceeds 85%.

Target Background

Function

Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.

Gene References into Functions

The studies revealed that, although overall structural and oligomerization features of CXCL3 and CXCL2 are similar, prominent differences were observed in their surface characteristics, thus implicating a functional divergence. PMID: 28928065
Taken together, the data of the present study demonstrated that TcpC can induce MIP2 production, which may contribute to the characteristic histological change associated with pyelonephritis. PMID: 28765918
Functional effects data suggested that recombinant human CXCL2 significantly enhanced the migration, invasion ability of SMMC7721 hepatocellular carcinoma cells, and weakened adhesion ability. PMID: 27117207
Reduced rate of sickle-related complications in Brazilian patients carrying HbF-promoting alleles at the BCL11A and HMIP-2 loci PMID: 26888013
Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403
Chronic inflammation contributes to the change of CXCL12 DNA methylation in buccal cells and that DNA methylation profile of CXCL12 promoter plays important role in development and progression of periodontal disease. PMID: 27580404
high GRO-beta expression correlates with poor prognosis and contributes to ovarian cancer tumorigenesis and metastasis. PMID: 26063953
In this review, a genetic variant in CXCL12 is described that is associated with type 2 diabetes mellitus and its complications. PMID: 25085744
We have demonstrated that GRObeta, as an oncogene product, contributed to tumorigenesis and metastasis of HCC PMID: 25801245
Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075
autophagy is required for Hepatitis B virus-induced NF-kappaB activation and release of IL-6, IL-8, and CXCL2 in Hepatocytes PMID: 25708728
The results link CXCL1 and CXCL2 chemokines with bone marrow adiposity and implicate CXCR2 signaling in promoting effects of marrow fat on progression of skeletal tumors in bone. PMID: 25802102
CXCL2 has antimicrobial activity against E. coli and S. aureus. PMID: 12949249
Simultaneous targeting of hCAP-G2 and MIP-2A is a promising strategy for the development of antitumor drugs as a treatment for intractable tumours. PMID: 24098805
our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration PMID: 23904157
CXCL12 and CXCR4 are related to formation of gastric tumors and lymph node metastasis PMID: 21630055
Ubiquinol decreases monocytic expression and DNA methylation of the pro-inflammatory CXCL2 gene in humans. PMID: 23021568
CXCL2, a WAT-produced chemokine being up-regulated in obesity, stimulates neutrophil adhesion to vis WAT endothelial cells. Activated neutrophils in obesity may influence vis WAT-ECs functions and contribute to WAT inflammation. PMID: 23372021
This is the first report showing the role of CXCL2 in cancer-associated bone destruction. PMID: 22771802
Anti-human ANXA1 antibodies and, to a lesser extent, anti-human ANXA4 antibodies increased MIP-2 or IL-8 production. PMID: 22056994
Data suggest that GRObeta may function as an oncogene product and contribute to tumorigenesis and metastasis of esophageal squamous cell carcinoma. PMID: 21677836
It can be hypothesized that for some targets, such as CXCL1 and CXCL2, additional signaling may be necessary to fully activate the 3'untranslated region-dependent human antigen R (HuR) function in airway epithelium PMID: 21220697
A significantly increased expression of GRO-2, GRO-3, and IL-8 in colon carcinoma as compared to normal tissue, is reported. PMID: 20162422
G-CSF stimulates the expression of the MIP-2 receptor via STAT3-dependent transcriptional activation of Il8rb PMID: 20185584
modulation of the GRO beta concentration in the endometrium by inflammatory mediators may contribute to the normal and pathological processes of human reproduction by regulating the trafficking of neutrophils into the endometrium PMID: 12892904
Neutrophil elastase, MIP-2, and TLR-4 have roles in progression of human sepsis and murine peritonitis PMID: 15614130
CXCL2 tandem repeat promoter polymorphism is associated with susceptibiltiy to severe sepsis in the Spanish population. PMID: 16421598
CXC chemokine CXCL10 and CC chemokine CCL2 serum levels increase with normal aging PMID: 16697212
Inhibition of ERK phosphorylation decreased expression of Grob. PMID: 17466952
data suggest that a tandem repeat polymorphism (AC)n at position -665 in the CXCL2 gene may be an independent predictor of mortality for severe sepsis PMID: 17944017
Decrease of CXCL1 and -2 mediated by Curcumin is involved in the inhibition of metastasis in breast cancer cells. PMID: 17999991
Peripheral neutrophilia and increased serum chemokines (IL-8 and MIP-2) may indicate hepatic injuries in glycogen storage disease type Ia. PMID: 18191274
Resident tissue macrophages are the major source of MIP-2 and KC chemokines; these chemokines are newly synthesized products of signaling through Toll-like receptors. PMID: 18322244
In colon epithelial cells, induction of MIP-2 alpha expression by tumor necrosis factor-alpha was accompanied by a concomitant reduction in miR-192 expression and miR-192 was observed to regulate the expression of MIP-2 alpha. PMID: 18835392
Report gonadotropin-releasing hormone-regulated CXCL2 expression in human placentation. PMID: 19369450

Hide All

Subcellular Location

Secreted.

Protein Families

Intercrine alpha (chemokine CxC) family

Database Links

HGNC: 4603

OMIM: 139110

KEGG: hsa:2920

STRING: 9606.ENSP00000427279

UniGene: Hs.75765

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP006248HU
Abbreviation	Recombinant Human CXCL2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human C-X-C motif chemokine 2 (CXCL2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage