Recombinant Human Granulocyte colony-stimulating factor(CSF3),partial (Active)

In Stock
Code CSB-AP003631HU
Product Type Colony Stimulating Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P09919
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0
Alias Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using NFS?60 mouse myelogenous leukemia lymphoblast cells is less than 0.2 ng/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Research Area Cancer
Source E.coli
Gene Names CSF3
Expression Region 31-204aa
Tag Info Tag-Free
Mol. Weight 18.8 kDa
Protein Description Partial of Isoform 2
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 2438

OMIM: 138970

KEGG: hsa:1440

STRING: 9606.ENSP00000225474

UniGene: Hs.2233

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway

Related Products

CSF3 Antibodies

CSF3 Antibodies for Human

CSF3 Antibodies for Homo sapiens (Human)

CSF3 Proteins

CSF3 Proteins for Homo sapiens (Human)

CSF3 ELISA Kit

CSF3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.