Recombinant Human Granulocyte colony-stimulating factor (CSF3),Partial (Active)

In Stock
Code CSB-MP006049HU-WD
Abbreviation Recombinant Human G-CSF protein, partial (Active)
MSDS
Size Inquiry
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
The activity is determined by the dose-dependent proliferation of murine NFS-60 cells is < 0.5 ng/ml, corresponding to a specific activity of ≥ 1 x 10^7 units/mg.
Target Names
G-CSF
Uniprot No.
Alternative Names
Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-204aa
Target Protein Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Mol. Weight
18.7 kDa
Protein Length
Partial
Tag Info
Tag free
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS,5% mannitoland 0.01% Tween 80, pH7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Granulocyte colony-stimulating factor drives neutrophil lineage commitment and mobilization, making it a critical tool for dissecting myeloid differentiation and emergency granulopoiesis. This tag-free protein, spanning residues 31–204 of the mature human sequence, demonstrates potent bioactivity with an ED50 below 0.5 ng/ml in NFS-60 cell proliferation assays, corresponding to a specific activity exceeding 1 × 10⁷ units/mg—a threshold that supports dose-response studies in primary hematopoietic progenitor cultures and JAK/STAT signaling pathway investigations. Endotoxin levels remain at or below 10 EU/mg, meeting the contamination criteria typical for immune cell functional assays where LPS artifacts would confound cytokine-specific responses. The combination of greater than 95% purity and validated proliferative activity provides a suitable basis for antibody development workflows, including use as an immunogen or ELISA standard in cytokine detection platforms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Gene References into Functions
  1. G-CSF and IL-6 concentrations may be predictive of the onset of neonatal Leukemoid reaction. PMID: 29459579
  2. we described the construction and characterization of three G-CSF dimeric proteins generated using different linker peptides. GCSF-Lalpha had the best performance in terms of purity and in vitro activity PMID: 28721592
  3. this study shows that cortisol inhibits CSF3 via DNA methylation and inhibits invasion in first-trimester trophoblast cells PMID: 28846166
  4. We propose that in aggressive pancreatic ductal adenocarcinoma , elevated G-CSF contributes to tumor progression through promoting increases in infiltration of neutrophil-like cells with high immunosuppressive activity. Such a mechanism provides an avenue for a neoadjuvant therapeutic approach for this devastating disease PMID: 28775207
  5. conclusion, there was an elevated lipolysis condition within the FF of Polycystic Ovary Syndrome (PCOS) with metabolic syndrome (MS) patients and the TNF-alpha and G-CSF levels in FF were associated with top-quality embryo percentage. PMID: 28082237
  6. a set of IL-17A-regulated genes in keratinocytes, which recapitulate typical psoriasis genes exemplified by DEFB4A, S100A7, IL19 and CSF3, based on the differences in the expression profiles of cells stimulated with six cytokines versus cells stimulated with only five cytokines lacking IL-17A. PMID: 26944069
  7. The results showed that the addition of recombinant IL-1 markedly increased G-CSF expression in fibroblasts; however, IL-1 receptor antagonist only partially abrogated KCM-stimulated G-CSF expression, indicating the role of additional keratinocyte-releasable factors PMID: 27340768
  8. Data reviewed establish that any damage to brain tissue tends to cause an increase in G-CSF and/or GM-CSF (G(M)-CSF) synthesized by the brain. Glioblastoma cells themselves also synthesize G(M)-CSF. G(M)-CSF synthesized by brain due to damage by a growing tumor and by the tumor itself stimulates bone marrow to shift hematopoiesis toward granulocytic lineages away from lymphocytic lineages. PMID: 28459367
  9. CD146/MCAM is the functional galectin-3-binding ligand on endothelial cell surfaces responsible for galectin-3-induced secretion of metastasis-promoting cytokines. PMID: 28364041
  10. These results suggest that G-CSF could decrease the Th1/Th2 ratio in the context of immune thrombocytopenic purpura, and elucidate the direct and indirect immunomodulatory mechanisms underlying G-CSF functions in Th1/Th2 cells. PMID: 27815970
  11. GCSF impairs CD8(+) T cell functionality by interfering with central activation elements. PMID: 26990855
  12. High expression of G-CSF is associated with Tongue squamous cell carcinoma. PMID: 27316348
  13. this study shows that haplotypes consisting of single nucleotide polymorphisms harboring PSMD3, CSF3 and MED24 genes are associated with asthma in Slovenian patients PMID: 27163155
  14. Cancer cells can produce IL-18, which is involved in the process of angiogenesis, stimulates invasion and metastasis. Decrease in SIPA for the production of IL-6 and GCSF by peripheral blood cells could serve as an indicator of malignant progression in invasive ductal breast carcinoma. PMID: 27021370
  15. G-CSF showed favorable effects only on the migration of HUVECs, and no direct influence was found on Osteoblasts. PMID: 27006951
  16. tumor G-CSF expression is an indicator of an extremely poor prognosis in cervical cancer patients that are treated with chemotherapy. PMID: 26666576
  17. G-CSF stimulates beta1 integrin expression and Swan 71 cell migration by activating PI3K and MAPK signaling pathways. PMID: 26992288
  18. these data suggest that G-CSF may contribute to tumor growth and decrease the antitumor effect of radiotherapy, possibly by promoting vascularization in cancer lesions. PMID: 25976379
  19. in vitro chemotaxis assays and an in vivo transplantation model for chemoattraction confirmed that UCX((R)) are chemotactic to CD34(-)/CD45(-) BM-MSCs via a cell-specific mobilization mechanism mediated by G-CSF. PMID: 24480602
  20. Case Report: undifferentiated colon carcinoma producing G-CSF. PMID: 25400792
  21. increases MMP-2 activity and VEGF secretion in trophoblasts through activation of PI3K/Akt and Erk signaling pathways PMID: 25249155
  22. Elevated IL-8 and G-CSF may be involved in the pathophysiology of narcolepsy. PMID: 24994458
  23. GM-CSF, through its stimulatory function on macrophages, may promote aneurysm progression. PMID: 25389911
  24. G-CSF constrains cancer to grow and progress by, respectively, supporting the survival of sympathetic nerve fibers in 6-hydroxydopamine-sympathectomized mice. PMID: 24975135
  25. Transgenic poultry with a gene of human granulocyte colony-stimulating factor (gcsf) was developed by arti- ficial insemination with the transfected sperm PMID: 25510103
  26. Data suggest that long-term protein secondary structural stability/unfolding of GCSF can be modeled from short-term physicochemical phenomena assessed via spectroscopic measurements. PMID: 24421157
  27. SCF+G-CSF treatment in chronic stroke remodels neural circuits in the aged brain PMID: 23750212
  28. The results demonstrated that 3DHSA-G-CSF has the ability to increase the peripheral white blood cell (WBC) counts of neutropenia model mice, and the half-life of 3DHSA-G-CSF is longer than that of native G-CSF. PMID: 24151579
  29. HNF1A gene was associated with C-reactive protein, and the region including PSMD3 and CSF3 genes was associated with white blood cell count. PMID: 22788528
  30. Administration of G-CSF in a dosage regimen commonly used for bone marrow donors is well tolerated and safe, and provides a signal of positive change in a task of cognitive performance in 8 patients with mild to moderate stage Alzheimer's disease. PMID: 22751169
  31. activation of the RAS/MEK/ERK pathway regulates G-CSF expression through the Ets transcription factor PMID: 23530240
  32. These data suggest that GCSF, which is raised in patient serum, may play an important role in exacerbating disease in ANCA vasculitis. PMID: 23087180
  33. CEACAM1 inhibits both G-CSF production by myeloid cells and G-CSF-stimulated tumor angiogenesis PMID: 23319418
  34. G-CSF level in sera of patients with advanced stages of breast cancer was elevated compared to early stages. PMID: 23244154
  35. G-CSF and VEGF levels in sera might be associated with an early phase of brain protection after birth in severe asphyxia treated with head cooling. PMID: 22944463
  36. Granulocyte-colony stimulating factor contributes to glioma progression that may be linked to glioma genesis and recurrence. PMID: 22313638
  37. Plasma G-CSF is elevated after injury and is greater in patients with shock. The rise in G-CSF is associated with prolonged mobilization of hematopoietic progenitor cells. PMID: 23063381
  38. Treatment of 6-week-old bone marrow stromal cells with GCSF significantly improves their proliferation activity and growth factor production and recovers therapeutic effects in the injured brain. PMID: 21981141
  39. Alteration of Dickkopf-1 and receptor activator of nuclear factor-kappaB ligand during PBSC mobilization in healthy donors by G-CSF. PMID: 22120987
  40. These findings suggest that IL-1beta, IL-1Ra, and granulocyte colony-stimulating factor are functional markers of EV71-related cardiac dysfunction. PMID: 22829643
  41. G-CSF administration at 10 mug/kg/day is safe for patients with worsening symptoms of compression myelopathy and may be effective for their neurological improvement. PMID: 21935680
  42. Non-small cell lung cancer specimens with G-CSF expression exhibited poor differentiation, remarkable atypia, prominent necrosis and infiltration of tumor mass by neutrophils or emperipolesis. PMID: 22336152
  43. Decreased soluble TGF-beta1, Tie-2, and angiopoietins serum levels in bone marrow after treating healthy donors with granulocyte colony-stimulating factor. PMID: 22465760
  44. Elevated plasma GCSF concentration was positively correlated with the severity of ischemic stroke PMID: 22440005
  45. Induction of Bv8 expression by granulocyte colony-stimulating factor in CD11b+Gr1+ cells: key role of Stat3 signaling. PMID: 22528488
  46. G-CSF can ameliorate cardiac diastolic dysfunction and morphological damage, especially fibrosis of the myocardium, in Otsuka Long-Evans Tokushima fatty rats with diabetic cardiomyopathy. PMID: 21999467
  47. Human recombinant G-CSF enhances angiogenesis following indirect bypass surgery, a combined therapy that is a safe and easy method of treatment. PMID: 21273924
  48. Case Report: diagnosis of G-CSF-producing ascending colon cancer. PMID: 22443081
  49. Prdx4 inhibits G-CSF-induced signalling and proliferation in myeloid progenitors. PMID: 22045733
  50. Data indicate that serum G-CSF levels were lower in JAK2 V617F-positive vs. negative erythrocytosis. PMID: 21645282

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-6 superfamily
Database Links

HGNC: 2438

OMIM: 138970

KEGG: hsa:1440

STRING: 9606.ENSP00000225474

UniGene: Hs.2233

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*