Recombinant Human Insulin-like growth factor II(IGF2) (Active)

In Stock
Code CSB-AP003891HU
Product Type Growth Factor
Size $117Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01344
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 5 mM HAC, PH 3.0
Alias Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 20 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Research Area Signal Transduction
Source E.coli
Gene Names IGF2
Expression Region 25-91aa
Tag Info Tag-Free
Mol. Weight 8.91 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable).
Involvement in disease Silver-Russell syndrome (SRS); Growth restriction, severe, with distinctive facies (GRDF)
Subcellular Location Secreted
Protein Families Insulin family
Tissue Specificity Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.
Database Links

HGNC: 5466

OMIM: 147470

KEGG: hsa:3481

STRING: 9606.ENSP00000391826

UniGene: Hs.272259

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Ras signaling pathway

Related Products

IGF2 Antibodies

IGF2 Antibodies for Human

IGF2 Antibodies for Homo sapiens (Human)

IGF2 Proteins

IGF2 Proteins for Homo sapiens (Human)

IGF2 ELISA Kit

IGF2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.