Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 20 ng/ml.
Research Area
Signal Transduction
Alternative Names
C11orf43; IGF 2; IGF II; IGF-II; IGF2; IGF2_HUMAN; IGFII; INSIGF; insulin like growth factor 2 (somatomedin A) ; Insulin like Growth Factor 2; Insulin like growth factor II; Insulin like growth factor II precursor; Insulin like growth factor type 2; pp9974; Preptin; putative insulin like growth factor II associated protein; Somatomedin A; Somatomedin-A
Species
Homo sapiens (Human)
Expression Region
25-91aa
Complete Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Protein Length
Full Length of Mature Protein
Buffer
Lyophilized from a 0.2 μm filtered 20mM Glycine-HCl, 4% Sucrose, 4% Mannitol, 0.02% Tween 80 (w/v), pH3.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.