Recombinant Mouse Fibroblast growth factor 17(Fgf17) (Active)

In Stock
Code CSB-AP004121MO
Size Inquiry How to order?
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Target Names Fgf17
Uniprot No. P63075
Research Area Signal Transduction
Alternative Names Fgf17Fibroblast growth factor 17; FGF-17
Species Mus musculus (Mouse)
Source E.coli
Expression Region 23-216aa
Complete Sequence TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
Mol. Weight 23.7 kDa
Protein Length Full Length of Mature Protein
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Gene References into Functions
  1. Cre fate mapping in Fgf17 mutant embryos revealed novel functions of this gene in rostral patterning center progenitor development. Disruption resulted in aberrant progenitor number and distribution in the rostral telencephalon. PMID: 25889070
  2. These results demonstrate that Fgf17 plays important roles in both the anatomical and functional development of the auditory midbrain PMID: 21356319
  3. The expression from early streak stage to midgestation of Fgf17 is measured. It is closely related to Fgf8 (63.7% identical at the amino acid level). Fgf17 is expressed during gastrulation but at lower levels than Fgf8. PMID: 9651520
  4. Fgf17 functions similar to Fgf8 in patterning the overall neocortical map PMID: 17442747
  5. Fgf17 is required for several complex social behaviors and suggest that disturbances in Fgf17 signaling may contribute to neuropsychiatric diseases that affect such behaviors. PMID: 17908176

Show More

Hide All

Subcellular Location Secreted.
Protein Families Heparin-binding growth factors family
Database Links

KEGG: mmu:14171

STRING: 10090.ENSMUSP00000022697

UniGene: Mm.12814

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1