Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004121MO |
| Product Type | Growth Factor |
| Size |
$137Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P63075 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4 |
| Alias | Fibroblast growth factor 17; FGF-17;fgf17 |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | Fgf17 |
| Expression Region | 23-216aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 23.7 kDa |
| Protein Description | Full Length of Mature Protein |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. |
| Subcellular Location | Secreted |
| Protein Families | Heparin-binding growth factors family |
| Database Links |
KEGG: mmu:14171 STRING: 10090.ENSMUSP00000022697 UniGene: Mm.12814 |
| Pathway |
MAPK signaling pathway
PI3K-Akt signaling pathway Regulation of actin cytoskeleton Ras signaling pathway Rap1 signaling pathway |
Fgf17 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP008622MO CSB-EP008622MO CSB-BP008622MO CSB-MP008622MO |
Recombinant Mouse Fibroblast growth factor 17(Fgf17) | Yeast E.coli Baculovirus Mammalian cell |
Fgf17 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL008622MO | Mouse Fibroblast growth factor 17(FGF17) ELISA kit | serum, plasma, tissue homogenates | 0.78 pg/mL |
-SDS.jpg)
Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
Express system: Yeast
Species:
Recombinant Rat Plasma kallikrein(Klkb1),Partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human ATP synthase subunit alpha, mitochondrial(ATP5F1A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Pig Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial(ETFDH)
Express system: E.coli
Species: Sus scrofa (Pig)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human 60S acidic ribosomal protein P0(RPLP0)
Express system: E.coli
Species: Homo sapiens (Human)
