Code | CSB-AP004121MO |
Product Type | Growth Factor |
Size | US$137 |
Uniprot No. | P63075 |
Lead Time | 5-10 business days |
Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4 |
Alias | Fibroblast growth factor 17; FGF-17;fgf17 |
Species | Mus musculus (Mouse) |
Biological_Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT |
Research Area | Signal Transduction |
Source | E.coli |
Gene Names | Fgf17 |
Expression Region | 23-216aa |
Tag Info | C-terminal 6xHis-tagged |
Mol. Weight | 23.7 kDa |
Protein Description | Full Length of Mature Protein |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. |
Subcellular Location | Secreted |
Protein Families | Heparin-binding growth factors family |
Database Links |
KEGG: mmu:14171 STRING: 10090.ENSMUSP00000022697 UniGene: Mm.12814 |
Pathway |
MAPK signaling pathway
PI3K-Akt signaling pathway Regulation of actin cytoskeleton Ras signaling pathway Rap1 signaling pathway |
Fgf17 Proteins for Mus musculus (Mouse)
Code | Product Name | Source |
---|---|---|
CSB-YP008622MO CSB-EP008622MO CSB-BP008622MO CSB-MP008622MO |
Recombinant Mouse Fibroblast growth factor 17(Fgf17) | Yeast E.coli Baculovirus Mammalian cell |
Fgf17 ELISA Kit for Mus musculus (Mouse)
Code | Product Name | Sample Types | Sensitivity |
---|---|---|---|
CSB-EL008622MO | Mouse Fibroblast growth factor 17(FGF17) ELISA kit | serum, plasma, tissue homogenates | 0.78 pg/mL |
Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Rabbit Apolipoprotein E(APOE),partial
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human N-acetylgalactosamine-6-sulfatase(GALNS)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Caveolin-1(CAV1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.