Recombinant Mouse Fibroblast growth factor 9 (Fgf9) (Active)

In Stock
Code CSB-AP004131MO
Abbreviation Recombinant Mouse Fgf9 protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Fgf9; Fgf-9Fibroblast growth factor 9; FGF-9; Glia-activating factor; GAF; HBGF-9
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-208aa
Complete Sequence
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Mol. Weight
24.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

FGF-9 plays a critical role in neuronal survival, lung development, and mesenchymal cell proliferation, making it a key target in both developmental biology and regenerative medicine research. This recombinant mouse Fgf9 covers the full-length sequence (aa 1–208) with an N-terminal 6xHis tag and demonstrates strong mitogenic potency, with an ED50 of 4.14 ng/ml in a Balb/3T3 fibroblast proliferation assay — a level of activity that supports use in cell proliferation and survival assays, neuronal or osteogenic differentiation studies, and angiogenesis or wound healing models. Expressed in *E. coli*, this protein is free of mammalian-derived glycosylation artifacts, providing a suitable basis for receptor-ligand binding and competition assays via SPR or ELISA where consistent post-translational uniformity matters. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and *in vivo* tumor biology or regenerative medicine studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Gene References into Functions
  1. stage-specific expression of FGF9 in XY gonads regulates different signal transduction pathways, ERK1/2 and p38, in XY primordial germ cells, resulting in the balance between proliferation and differentiation of the cells PMID: 28395336
  2. the localization of FGF9 and its receptors at different embryonic and postnatal stages in mice testes, was examined. PMID: 27078042
  3. results suggested that the combination of nCS (to support bone formation) with a fibrin-based VEGF/FGF9 release system (support vascular formation) is an innovative and effective strategy that significantly enhanced ectopic bone formation in vivo. PMID: 27269204
  4. FGF9 is a crucial factor required for establishing an appropriate microenvironment for successful implantation and for pregnancy establishment. Additional analyses of pathways through which FGF9 participates in angiogenesis and endometrium-embryo communication should contribute to the understanding of molecular mechanisms that underlay process of implantation. PMID: 28848153
  5. we conclude that the S99N mutation in Fgf9 causes multiple synostoses syndrome (SYNS) via the disturbance of joint interzone formation. These results further implicate the crucial role of Fgf9 during embryonic joint development PMID: 28169396
  6. Our results suggest that mature osteoblasts are an important source of FGF9, positively regulating skeletal homeostasis in male mice PMID: 28189801
  7. suggests FGF-9 has the potential to attenuate vascular cell apoptosis, activate c-Kit progenitor cells, and enhance angiogenesis and neovascularization in C57BL/6 and db/db mice leading to improved cardiac function. PMID: 26682010
  8. Sox11 directly regulates the expression of Fgf9; ablation of the Sox11 gene results in clefting of the secondary palate resembling the Pierre Robin sequence. PMID: 26826126
  9. data demonstrated that overexpressing FGF9 in PCa cells augmented the formation of reactive stroma and promoted PCa initiation and progression PMID: 26157349
  10. These studies identify FGF9 as a target of DICER1 in lung epithelium that functions as an initiating factor for pleuropulmonary blastoma. PMID: 25978641
  11. FGF-9 possesses novel therapeutic potential in its ability to mediate monocyte to M2 differentiation and confer cardiac protection in the post-infarction diabetic heart. PMID: 25768089
  12. Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID: 25915623
  13. cerebellar microexplant cultures treated with an FGFR agonist or antagonist, we also show that FGF9/FGFR-mediated signaling inhibits the outward migration of radial glia and Bergmann glia precursors and cells PMID: 24983448
  14. our data demonstrate that FGF9 can initiate a complex astrocytic response predicted to compromise remyelination, while at the same time stimulating microglial/macrophage recruitment in multiple sclerosis lesions PMID: 25907862
  15. Demonstrate the complex role of FGF9-FGFR3 signalling in the initiation, growth and propagation of lung cancer. PMID: 25413587
  16. FGF9 overexpression in lung leads to adenocarcinoma. PMID: 23867472
  17. Loss of Fgf9 in XX Wnt4-/- gonads does not rescue their partial female-to-male sex-reversal. PMID: 22705479
  18. The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID: 22698282
  19. TGFbeta-FGF9-PITX2 signaling cascade regulates cranial neural crest cell proliferation during palate formation. PMID: 22123828
  20. Data point to a role of Fgf9 signalling in primary and secondary lens fiber cell growth. PMID: 21858205
  21. Data demonstrate that mesothelial- and epithelial-derived FGF9, mesenchymal Wnt2a and epithelial Wnt7b have unique functions in lung development in mouse. PMID: 21750028
  22. Conditional expression of FGF9 promotes myocardial vascularization and hypertrophy with enhanced systolic function and reduced heart failure mortality after MI PMID: 21262993
  23. Results suggest collectively that Fgf9 signalling from the outer mesothelial lining induce Spred/Sprouty expression in the underlying pancreatic mesenchyme. PMID: 20934536
  24. Fgf9 stimulates steroidogenesis in postnatal Leydig cells. PMID: 19508331
  25. data suggest a unique role for Fgf-9 in bone healing, presumably by initiating angiogenesis through Vegf-a PMID: 20547837
  26. Data demonstrate that FGF9 can act as a diffusible conductor for a poleward expansion of tubulogenic programs at early phases of testis differentiation. PMID: 20040496
  27. Recombinant fgf9 protein inhibits the differentiation response of the mesoderm to Shh, but does not affect proliferation. PMID: 12781691
  28. Data show that Fgf9 is necessary for testis development, playing a role in the proliferation of cells that give rise to Sertoli progenitors and in the nuclear localization of FGF receptor R2 in Sertoli cell precursors. PMID: 15229180
  29. To address the role of Fgf9 signaling, we analyzed the inner ears of mice homozygous for Fgf9 null alleles. Fgf9 inactivation leads to a hypoplastic vestibular component of the otic capsule and to the absence of the epithelial semicircular ducts. PMID: 15328018
  30. FGF9 plays an important role in proliferation and organisation of embryonic Sertoli cells during testis morphogenesis PMID: 15470636
  31. An epithelial FGF9 signal is necessary for the expansion of cecal mesenchyme and the expression of mesenchymal genes that are required for epithelial budding. PMID: 16308329
  32. FGF9 acts on the lung mesenchyme to induce proliferation and decrease differentiation PMID: 16494859
  33. FGF9 is necessary for 11.5 days post coitum fetal XY gonocyte survival and is the earliest reported factor with a sex-specific role in regulating germ cell survival. PMID: 16540514
  34. the Sprouty proteins are involved normally in mediating the sexually dimorphic signaling of FGF9 and controlling cell migration from the mesonephros during testis development PMID: 16675530
  35. The fate of the gonad is controlled by antagonism between Fgf9 and Wnt4. PMID: 16700629
  36. Although Fgf9 is expressed in the apical ectodermal ridge in the limb bud, we demonstrate that the Fgf9-/- limb phenotype results from loss of FGF9 functions after formation of the mesenchymal condensation. PMID: 17544391
  37. These data suggest a molecular mechanism through which FGF9 and sonic hedgehog signaling coordinately control the growth and patterning of the lung capillary plexus, and regulate the temporal and spatial expression of Vegfa. PMID: 17881491
  38. The interaction of FGF and TGFbeta signaling pathways in the intestinal mesenchyme could represent novel targets for future short bowel syndrome therapies. PMID: 18653563
  39. Results show that loss of fibroblast growth factor 9 or conditional inactivation of Fgf receptors (Fgfr) 1 and 2 in mouse lung mesenchyme results in ectopic airway smooth muscle cells. PMID: 19097117
  40. A mechanism in which the range of FGF9 signaling in developing tissues is limited by its ability to homodimerize and its affinity for extracellular matrix heparan sulfate proteoglycans. PMID: 19219044
  41. Neuron-derived Fgf9 is essential for scaffold formation of Bergmann radial fibers and migration of granule neurons in the cerebellum. PMID: 19232523
  42. the PGD2 signaling pathway is likely to act independently of FGF9, thus implicating two independent feedforward loops between Sox9/Fgf9 and Sox9/L-Pgds in the coordination of growth, cell differentiation and morphogenesis of the gonad. PMID: 19429785

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*