Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial (Active)

In Stock
Code CSB-AP004551HU
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml.
Target Names IL15RA
Uniprot No. Q13261
Research Area Immunology
Alternative Names AA690181; CD215; I15RA_HUMAN; IL 15R alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; Il15ra; Interleukin 15 receptor alpha ; Interleukin 15 receptor subunit alpha; MGC104179; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA; Soluble interleukin 15 receptor subunit alpha; Soluble interleukin-15 receptor subunit alpha
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 31-205aa
Complete Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Mol. Weight 45.5 kDa
Protein Length Partial
Tag Info C-terminal hFc-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.
Gene References into Functions
  1. Men with the IL-15Ralpha 1775AA genotype spent more time in light intensity physical activity (39.4 +/- 2.4 hr/week) than men with the CC genotype (28.6 +/- 2.3 hr/week, (p = .009). PMID: 29624921
  2. this study describes variants of splicing of IL-15Ra expressed in intestinal epithelial cells, and identifies those variants with the ability of binding IL-15 and following the secretory pathway, as well as determines if any of these variants are regulated by methylation of DNA PMID: 27794069
  3. significant association of rs2228059 with ossification of the posterior longitudinal ligament of the spine in Chinese Han population PMID: 25387549
  4. Report Il15Ralpha levels in synovial fluid from rheumatoid arthritis patients. PMID: 25879761
  5. NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15Ralpha expression PMID: 25412359
  6. Coexpression of IL15RA and IL15 was also sufficient to activate peripheral blood mononuclear cells. PMID: 24980552
  7. our study provides strong evidence that the functional IL-15RA rs2228059 A>C polymorphism may contribute to the risk of ESCC. PMID: 24464181
  8. We show that a gene transfer approach using recombinant adenovirus to express IL-15 and IL-15Ralpha in murine TRAMP-C2 prostate or TS/A breast tumors induced antitumor immune responses PMID: 24572789
  9. This present study demonstrated that IL15RA rs2228059 A > C polymorphism might modify Gastric cardiac adenocarcinoma susceptibility PMID: 24696261
  10. The proportion of IL-15Ralpha expression on total leukocytes was much lower for all rheumatic diseases, including Behcet disease, than in healthy controls PMID: 23417200
  11. Single nucleotide polymorphism in IL15RA gene is associated with ER-positive breast cancers only in American women of African ancestry. PMID: 23996684
  12. lower frequencies of IL-15RA-positive T cells in Behcet's disease PMID: 23618691
  13. Epidermal IL-15Ralpha acts as an endogenous antagonist of psoriasiform inflammation in mouse and man. PMID: 24019554
  14. The inflammatory bowel diseases patients have an increased expression of IL-15Ralpha mRNA in the mucosa; expression is localized in B cells, suggesting that IL-15 regulates B-cell functions during bowel inflammation. PMID: 23039249
  15. The expression of IL-15Ralpha on CD8 T cells is required for uncontrolled aggressive lymphoproliferation; none of the IL-15Ralpha(-/-)-IL-15 mice that we followed for more than 2 years developed the fatal disease despite controlled expansion of CD8 T cells PMID: 21304101
  16. IL-15 is produced and secreted only as a heterodimer with IL-15Ralpha. PMID: 22496150
  17. High serum IL-15R alpha is associated with T-cell large granular lymphocyte leukemia. PMID: 22049515
  18. These results suggest that IL15RA polymorphism may be associated with the susceptibility of ossification of the posterior longitudinal ligament in Korean population. PMID: 21689944
  19. Different levels of IL-15 trans-presentation are required for different natural killer (NK) cell developmental events to reach full maturation status PMID: 21715685
  20. broad expression pattern of functional IL-15RA splicing forms and suggests a regulatory role of DNA methylation in IL-15RA transcript Var1 expression in mononuclear cells PMID: 21097393
  21. mRNA for IL-15 receptor alpha was constitutively expressed in all tested human fetal brain structures, indicating a role in their development and physiology PMID: 12114302
  22. interleukin-15alpha receptor binds to IL-15 at specific binding sites, one in the B helix and the other in the C helix PMID: 15039446
  23. Soluble IL-15R alpha arises from proteolytic shedding of the membrane-anchored receptor. It is an inhibitor of IL-15 binding to the membrane receptor & of IL-15-induced cell proliferation. IL-15R alpha shedding may have major immunoregulatory functions. PMID: 15265897
  24. IL-15 is an important mediator of muscle mass response to resistance exercise training in humans and that genetic variation in IL15RA accounts for a significant proportion of the variability in this response. PMID: 15531573
  25. Study of three-dimensional structure of IL-15 receptor (IL-15R) alpha chain has led to a model of the IL-15.IL-15R alpha complex that reveals involvement of a large network of ionic interactions not observed in other cytokine/cytokine receptor complexes. PMID: 16377614
  26. Results show that the biological activity of soluble IL-15 is much improved after interaction with recombinant soluble IL-15Ralpha. PMID: 16757567
  27. Data show that NK cell survival mediated through the regulatory synapse with human dendritic cells requires IL-15Ralpha. PMID: 17948125
  28. sIL-15Ralpha has a protumor role in cancer PMID: 18483276
  29. genetic variability of the IL-15 receptor has an important role in body fat composition. PMID: 19309557
  30. IL-15 receptor alpha facilitates the stability and secretion of the IL-15 short signal peptide, a soluble and bioactive isoform. PMID: 19696432

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Note=Mainly found associated with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 5: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 6: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 7: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein
Tissue Specificity Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15R
Database Links

HGNC: 5978

OMIM: 601070

KEGG: hsa:3601

STRING: 9606.ENSP00000369312

UniGene: Hs.445124

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1