Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial (Active)

In Stock
Code CSB-AP004551HU
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml.
Target Names IL15RA
Uniprot No. Q13261
Research Area Immunology
Alternative Names CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 31-205aa
Complete Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Mol. Weight 45.5 kDa
Protein Length Partial
Tag Info C-terminal FC-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.
Subcellular Location Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Note=Mainly found associated with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 5: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 6: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 7: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein
Tissue Specificity Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15R
Database Links

HGNC: 5978

OMIM: 601070

KEGG: hsa:3601

STRING: 9606.ENSP00000369312

UniGene: Hs.445124

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.