Recombinant Human Interleukin-17F (IL17F) (Active)

In Stock
Code CSB-AP004461HU
Abbreviation Recombinant Human IL17F protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CANDF6; Cytokine ML 1; Cytokine ML-1; IL 17F; IL 24; IL-17F; IL-24; Il17f; IL17F_HUMAN; Interleukin 17F; Interleukin 24; Interleukin-17F; Interleukin-24; ML 1; ML1; Mutant IL 17F; OTTHUMP00000016602
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-163aa
Complete Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Mol. Weight
15.96 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Interleukin-17F (IL17F) is produced in a mammalian expression system and represents a full-length mature protein with a C-terminal 6xHis tag. The product shows purity greater than 95% as determined by SDS-PAGE analysis. Biological activity appears confirmed through binding ability in a functional ELISA. Endotoxin levels remain below 1.0 EU/µg, which likely makes it suitable for research applications.

Interleukin-17F (IL17F) is a cytokine that participates in immune responses, mainly produced by activated T cells. It seems to play an important role in inflammatory responses and belongs to the IL-17 family of cytokines, which may be critical for host defense against pathogens. IL17F appears involved in signaling pathways that contribute to inflammation and represents a key area of interest in research related to immune regulation and inflammatory diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IL-17 Receptor Binding Studies and Interaction Analysis

This recombinant IL-17F protein can investigate the binding kinetics and affinity between IL-17F and its receptors, particularly IL-17RA as shown by the functional ELISA activity test. Researchers might use surface plasmon resonance, bio-layer interferometry, or similar biophysical techniques to characterize the binding parameters. Comparisons with other IL-17 family members could prove valuable. The C-terminal His-tag appears to simplify immobilization and detection in these binding assays. Studies like these would likely contribute to understanding the molecular basis of IL-17F receptor recognition and specificity.

2. Antibody Development and Characterization

The high purity and biological activity of this IL-17F protein may make it suitable as an immunogen for generating research antibodies. It could also serve as a standard for characterizing existing anti-IL-17F antibodies. The protein might work well in ELISA-based screening of hybridoma clones or in validating antibody specificity and cross-reactivity. His-tag presence allows for easier purification and immobilization for antibody binding assays. Low endotoxin levels suggest minimal interference in cell-based antibody validation experiments.

3. Competitive Binding Assays for IL-17 Family Studies

This recombinant IL-17F could work in competitive binding experiments to study receptor binding preferences among IL-17 family cytokines. Researchers might investigate whether IL-17F competes with IL-17A or other family members for receptor binding sites. The established IL-17RA binding assay could provide a foundation for such work. The defined ED50 value offers a quantitative reference point for designing competition experiments. Studies of this nature would likely help clarify the relative receptor affinities and potential functional redundancies within the IL-17 cytokine family.

4. Structural and Biochemical Characterization Studies

The mammalian-expressed IL-17F protein with proper folding and biological activity may serve as a substrate for structural biology applications. This includes crystallization trials and NMR studies. The protein's confirmed receptor binding activity suggests proper tertiary structure formation, which could make it suitable for biophysical characterization techniques. Circular dichroism spectroscopy or analytical ultracentrifugation appear to be viable options. The His-tag simplifies purification for these applications while the high purity likely minimizes interference from contaminants in structural analyses.

5. Cell-Free Biochemical Assays and Protein-Protein Interaction Studies

This biologically active IL-17F protein might work in cell-free systems to study downstream signaling pathway components and identify novel IL-17F-interacting proteins. Pull-down experiments using the His-tag could help identify binding partners from cell lysates or purified protein libraries. The low endotoxin content suggests that any observed effects in subsequent cell-based validation experiments are likely due to IL-17F activity rather than contamination. The established binding activity provides confidence that the protein maintains its native conformation for interaction studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*