Recombinant Human Interleukin-17F (IL17F) (Active)

In Stock
Code CSB-AP004461HU
Abbreviation Recombinant Human IL17F protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CANDF6; Cytokine ML 1; Cytokine ML-1; IL 17F; IL 24; IL-17F; IL-24; Il17f; IL17F_HUMAN; Interleukin 17F; Interleukin 24; Interleukin-17F; Interleukin-24; ML 1; ML1; Mutant IL 17F; OTTHUMP00000016602
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-163aa
Complete Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Mol. Weight
15.96 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

IL-17F plays a central role in mucosal immunity and inflammatory tissue remodeling, making precise functional characterization essential for studies of Th17-driven pathology. This recombinant human IL-17F encompasses the full mature protein (aa 31–163), expressed in mammalian cells with a C-terminal 6xHis tag, and demonstrates confirmed binding to immobilized mouse IL-17RA-Fc with an ED50 of 47.94 ng/ml in functional ELISA—validating its suitability as a coating antigen for antibody screening, a positive control in cytokine detection assays, and a ligand in receptor-binding studies. The endotoxin level below 1.0 EU/μg minimizes LPS-driven artifacts in cell-based assays examining NF-κB or MAPK activation downstream of IL-17RA engagement, and supports use in primary cell stimulation experiments or in vivo inflammation models where innate immune confounders must be excluded. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, provides a suitable basis for quantitative signaling pathway dissection and antibody development workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*