Recombinant Human Interleukin-17F (IL17F) (Active)

In Stock
Code CSB-AP004461HU
Abbreviation Recombinant Human IL17F protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CANDF6; Cytokine ML 1; Cytokine ML-1; IL 17F; IL 24; IL-17F; IL-24; Il17f; IL17F_HUMAN; Interleukin 17F; Interleukin 24; Interleukin-17F; Interleukin-24; ML 1; ML1; Mutant IL 17F; OTTHUMP00000016602
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-163aa
Complete Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Mol. Weight
15.96 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Interleukin-17F (IL17F) is produced in a mammalian expression system and represents a full-length mature protein with a C-terminal 6xHis tag. The product shows purity greater than 95% as determined by SDS-PAGE analysis. Biological activity appears confirmed through binding ability in a functional ELISA. Endotoxin levels remain below 1.0 EU/µg, which likely makes it suitable for research applications.

Interleukin-17F (IL17F) is a cytokine that participates in immune responses, mainly produced by activated T cells. It seems to play an important role in inflammatory responses and belongs to the IL-17 family of cytokines, which may be critical for host defense against pathogens. IL17F appears involved in signaling pathways that contribute to inflammation and represents a key area of interest in research related to immune regulation and inflammatory diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IL-17 Receptor Binding Studies and Interaction Analysis

This recombinant IL-17F is confirmed to be biologically active in binding to IL-17RA (ED₅₀ 47.94 ng/ml) and suitable for receptor interaction studies. However, the C-terminal His-tag may cause steric hindrance near the receptor-binding interface, potentially affecting binding kinetics. While mammalian expression ensures proper folding and glycosylation, researchers should validate binding affinity using tag-free IL-17F for precise measurements. The use of mouse IL-17RA in the validation assay may not fully represent human IL-17RA binding characteristics.

2. Antibody Development and Characterization

The mammalian-expressed IL-17F serves as a good antigen due to proper folding, but the C-terminal His-tag may induce tag-specific antibodies, reducing antibodies against native C-terminal epitopes. Comprehensive validation should include testing against tag-free IL-17F to ensure recognition of physiological forms. The low endotoxin supports cell-based validation, but antibodies should be tested for neutralization of IL-17F biological function.

3. Competitive Binding Assays for IL-17 Family Studies

The protein can be used in competitive binding assays, but the His-tag may alter binding kinetics compared to untagged IL-17 family members, potentially skewing competition results. The relatively high ED₅₀ (47.94 ng/ml) suggests moderate binding affinity; competition studies should include tag-free controls and validate results in cellular assays. Comparisons with IL-17A should account for differences in receptor affinity and signaling potency.

4. Structural and Biochemical Characterization Studies

The protein is challenging for structural studies without tag removal, as the His-tag may impede crystallization or cause heterogeneity. While mammalian glycosylation supports native-like folding, the tag may affect protein packing in crystals. For biophysical studies (e.g., CD, AUC), the tag may alter hydrodynamic properties. Structural studies would require tag cleavage and isolation of the pure IL-17F domain.

5. Cell-Free Biochemical Assays and Protein-Protein Interaction Studies

The His-tag facilitates pull-down assays but may increase non-specific binding or mask interaction sites. While useful for initial interaction screens, identified binding partners should be validated with tag-free IL-17F. The mammalian expression ensures proper folding, but the tag may interfere with interactions involving the C-terminal region. Low endotoxin minimizes false positives in cell-based validation.

Final Recommendation & Action Plan

This mammalian-expressed human IL-17F with a C-terminal His-tag is a valuable tool for binding and interaction studies, but the tag necessitates careful experimental design. For immediate use: 1) In binding studies, employ the ED₅₀ (≈50 ng/ml) as a starting point but validate kinetics with tag-free protein if precise affinity measurements are needed; 2) For antibody development, use this protein for immunization but screen clones against tag-free IL-17F to avoid tag-specific antibodies; 3) In competition assays, include controls for tag-related artifacts and confirm functional relevance in cellular models; 4) For structural work, cleave the His-tag prior to crystallization trials; 5) For interaction screens, use stringent controls (e.g., tag-only) and validate hits with full-length, tag-free protein. The mammalian expression ensures proper glycosylation, which is important for IL-17F's stability and function, but the C-terminal tag may affect interactions near the receptor-binding interface. Always include appropriate controls and consider tag cleavage for applications requiring native protein conformation. For cellular studies, the protein is suitable, but verify that biological activity matches tag-free IL-17F in relevant disease models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*