Recombinant Bovine Alpha-2-HS-glycoprotein (AHSG) (Active)

In Stock
Code CSB-MP001485BO-WD
Abbreviation Recombinant Bovine Fetuin A protein (Active)
MSDS
Size $400
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
≤0.5EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using B16-F1 cells. Recombinant Bovine Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is ≤100 μg/mL.Optimal concentration depends on cell type as well as the application or research objectives.
Target Names
Fetuin A
Uniprot No.
Alternative Names
Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA
Species
Bos taurus (Bovine)
Source
Mammalian cell
Expression Region
19-359aa
Target Protein Sequence
IPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI
Mol. Weight
36.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing 10 mM PB, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Alpha-2-HS-glycoprotein functions as a multivalent transport protein and mineralization regulator, binding calcium, fatty acids, and various signaling molecules to modulate their bioavailability in serum and extracellular fluids. This full-length mature protein (aa 19–359) demonstrates functional cell adhesion activity with an ED50 ≤100 μg/mL in B16-F1 melanoma cells, confirming that the recombinant form retains the native conformational epitopes required for integrin-mediated interactions. The validated adhesion activity supports its use in ligand-binding assays investigating cargo association and release kinetics, drug-protein binding studies examining small molecule interactions with serum transport proteins, and membrane transporter functional assays where fetuin A modulates receptor-mediated uptake. Purity exceeding 95% by SDS-PAGE and endotoxin levels ≤0.5 EU/mg satisfy the quality criteria typical for cell-based functional assays and structural characterization experiments requiring minimal contaminant interference.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Suggested to have lymphocyte stimulating properties, lipid binding capability and to bind thyroid hormone.
Gene References into Functions
  1. two glycoproteins, AHSG and HPX, represent a pivotal glycoprotein of the cytoprotective activity for WN1316, showing a concrete evidence for the novel glycan-independent function of serum glycoproteins in neuroprotective drug efficacy. PMID: 29016670
  2. Site-specific analysis of the O-glycosylation of bovine fetuin by electron-transfer dissociation mass spectrometry. PMID: 24907489
  3. These experiments revealed a second mechanism of long-term mineral ion stabilization by the fetuin-A that is complementary to the formation of calciprotein particles. PMID: 21156141
Subcellular Location
Secreted.
Protein Families
Fetuin family
Tissue Specificity
Liver and bone.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*