Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The esterase activity is determined to be is 162.5 pmol/min/μg.

Target Names

CA8

Uniprot No.

P35219

Research Area

Cancer

Alternative Names

CA VIII; CA-VIII; Ca8; CAH8_HUMAN; CALS; Carbonic anhydrase related protein; Carbonic anhydrase VIII; Carbonic anhydrase-related protein; CARP; MGC120502; MGC99509

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-290aa

Complete Sequence

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Mol. Weight

34.04 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

0.2 μm Filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Human CA8 protein serves as a valuable research tool for scientists studying cancer biology. Carbonic anhydrase-related protein (CARP), also known as CA8, is expressed in E. coli and features a partial expression region from 2-290aa. The protein is fused with a C-terminal 6xHis-tag for easy purification and identification. The lyophilized powder format allows for simple reconstitution with sterile water or buffer, accommodating various experimental requirements.

The Recombinant Human CA8 protein demonstrates high quality and performance, with a purity greater than 95%, as determined by SDS-PAGE analysis. Furthermore, endotoxin levels are maintained below 1.0 EU/µg, as assessed by the LAL method. The protein exhibits esterase activity greater than 100 pmol/min/ug, highlighting its functionality for relevant applications.

Human CA8 has been the focus of numerous research studies due to its implications in cancer biology. For instance, Ghandour et al. (2007)^[1] and Maresca et al. (2013)^[2] contributed to a better understanding of the function and potential clinical applications of CA8. These studies emphasize the role of CA8 in cellular processes and its potential therapeutic value in cancer treatment.

References:
1. Ghandour H, et al. Carbonic anhydrase-related protein (CARP VIII) in cancer. Subcell Biochem. 2014;75:217-34.
2. Maresca A, et al. Potential therapeutic agents for the treatment of carbonic anhydrase-related diseases. Expert Opin Ther Pat. 2013;23(7):883-95.

Target Background

Function

Does not have a carbonic anhydrase catalytic activity.

Gene References into Functions

we observed increased expression of CA8 in more aggressive types of human osteosarcoma (OS) cells and found that CA8 expression is correlated with disease stages, such that more intense expression occurs in the disease late stage PMID: 26711783
CA8 overexpression desensitizes neuronal cells to STS induced apoptotic stress and increases cell migration and invasion ability in neuronal cells. PMID: 24794067
Overexpression of CA8 in MERRF cybrids significantly decreases cell death. PMID: 24476000
This report expands the neurological and radiological phenotype associated with CA8 mutations. PMID: 21812104
review article describes the previous data on CARP VIII, including its structure, role in neurodegeneration and cancer; and bioinformatic and expression analyses. PMID: 20819067
Crystal structure of human carbonic anhydrase-related protein VIII reveals the basis for catalytic silencing PMID: 19360879
Overexpression of Carbonic anhydrase-related protein VIII promotes colon cancer cell growth PMID: 17219437
The results suggest that the variations of CA8 and CA10 loci may be important determinants of osteoporosis in Japanese women. PMID: 19172221
Consanguineous Iraqi family in which affected siblings had mild mental retardation and congenital ataxia characterized by quadrupedal gait. The mutation S100P is associated with proteasome-mediated degradation, and presumably represents a null mutation. PMID: 19461874

Hide All

Involvement in disease

Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)

Protein Families

Alpha-carbonic anhydrase family

Database Links

HGNC: 1382

OMIM: 114815

KEGG: hsa:767

STRING: 9606.ENSP00000314407

UniGene: Hs.654388

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-AP005421HU
MSDS	MSDS
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Carbonic anhydrase-related protein (CA8), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage