Recombinant Human Carbonic anhydrase-related protein(CA8),partial (Active)

In Stock
Code CSB-AP005421HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The esterase activity is determined to be greater than 100 pmol/min/ug
Target Names CA8
Uniprot No. P35219
Research Area Cancer
Alternative Names Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-290aa
Complete Sequence ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Mol. Weight 34.04 kDa
Protein Length Partial
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function Does not have a carbonic anhydrase catalytic activity.
Involvement in disease Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families Alpha-carbonic anhydrase family
Database Links

HGNC: 1382

OMIM: 114815

KEGG: hsa:767

STRING: 9606.ENSP00000314407

UniGene: Hs.654388

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.