Recombinant Human Carbonic anhydrase-related protein (CA8), partial (Active)

In Stock
Code CSB-AP005421HU
Abbreviation Recombinant Human CA8 protein, partial (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The esterase activity is determined to be is 162.5 pmol/min/μg.
Target Names
CA8
Uniprot No.
Research Area
Cancer
Alternative Names
CA VIII; CA-VIII; Ca8; CAH8_HUMAN; CALS; Carbonic anhydrase related protein; Carbonic anhydrase VIII; Carbonic anhydrase-related protein; CARP; MGC120502; MGC99509
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-290aa
Complete Sequence
ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Mol. Weight
34.04 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
0.2 μm Filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Human CA8 protein serves as a valuable research tool for scientists studying cancer biology. Carbonic anhydrase-related protein (CARP), also known as CA8, is expressed in E. coli and features a partial expression region from 2-290aa. The protein is fused with a C-terminal 6xHis-tag for easy purification and identification. The lyophilized powder format allows for simple reconstitution with sterile water or buffer, accommodating various experimental requirements.

The Recombinant Human CA8 protein demonstrates high quality and performance, with a purity greater than 95%, as determined by SDS-PAGE analysis. Furthermore, endotoxin levels are maintained below 1.0 EU/µg, as assessed by the LAL method. The protein exhibits esterase activity greater than 100 pmol/min/ug, highlighting its functionality for relevant applications.

Human CA8 has been the focus of numerous research studies due to its implications in cancer biology. For instance, Ghandour et al. (2007)[1] and Maresca et al. (2013)[2] contributed to a better understanding of the function and potential clinical applications of CA8. These studies emphasize the role of CA8 in cellular processes and its potential therapeutic value in cancer treatment.

References:
1. Ghandour H, et al. Carbonic anhydrase-related protein (CARP VIII) in cancer. Subcell Biochem. 2014;75:217-34.
2. Maresca A, et al. Potential therapeutic agents for the treatment of carbonic anhydrase-related diseases. Expert Opin Ther Pat. 2013;23(7):883-95.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Does not have a carbonic anhydrase catalytic activity.
Gene References into Functions
  1. we observed increased expression of CA8 in more aggressive types of human osteosarcoma (OS) cells and found that CA8 expression is correlated with disease stages, such that more intense expression occurs in the disease late stage PMID: 26711783
  2. CA8 overexpression desensitizes neuronal cells to STS induced apoptotic stress and increases cell migration and invasion ability in neuronal cells. PMID: 24794067
  3. Overexpression of CA8 in MERRF cybrids significantly decreases cell death. PMID: 24476000
  4. This report expands the neurological and radiological phenotype associated with CA8 mutations. PMID: 21812104
  5. review article describes the previous data on CARP VIII, including its structure, role in neurodegeneration and cancer; and bioinformatic and expression analyses. PMID: 20819067
  6. Crystal structure of human carbonic anhydrase-related protein VIII reveals the basis for catalytic silencing PMID: 19360879
  7. Overexpression of Carbonic anhydrase-related protein VIII promotes colon cancer cell growth PMID: 17219437
  8. The results suggest that the variations of CA8 and CA10 loci may be important determinants of osteoporosis in Japanese women. PMID: 19172221
  9. Consanguineous Iraqi family in which affected siblings had mild mental retardation and congenital ataxia characterized by quadrupedal gait. The mutation S100P is associated with proteasome-mediated degradation, and presumably represents a null mutation. PMID: 19461874

Show More

Hide All

Involvement in disease
Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families
Alpha-carbonic anhydrase family
Database Links

HGNC: 1382

OMIM: 114815

KEGG: hsa:767

STRING: 9606.ENSP00000314407

UniGene: Hs.654388

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*